KEGG   Bacillus megaterium DSM 319: BMD_0791Help
Entry
BMD_0791          CDS       T01219                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2196
Motif
Other DBs
NCBI-ProteinID: ADF37653
UniProt: D5DB02
Position
complement(767423..767620)
Genome map
AA seq 65 aa AA seqDB search
MNGQNRKDVAPGIEVDIVLKADQRSGKLTHGTVKDILTNSSFHPHGIKVRLTDGQVGRIK
EIYPN
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacaaaatagaaaagacgtagctcctggaattgaagtcgacattgttttaaaa
gcagatcagcgttctggaaaacttacacacggaacggtcaaagacattctgaccaattca
agctttcacccacacggcatcaaagtccgtttaacagatggacaagtcggacgcataaaa
gaaatttacccaaattaa

DBGET integrated database retrieval system