KEGG   Bacillus megaterium DSM 319: BMD_0793Help
Entry
BMD_0793          CDS       T01219                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR PadR SelB-wing_2
Motif
Other DBs
NCBI-ProteinID: ADF37655
UniProt: D5DB04
Position
complement(767884..768252)
Genome map
AA seq 122 aa AA seqDB search
MKKYNIPVEAALEVIGGKWKVVILCHLIKGTKRPGELKRIMPRVTQKVLTQQLRELEADG
IIVRKMYNEMPPRVEYSLTDYGWSLKSILDSLCSWGEHHIEKTYPDKEAVLMQPVEEVTV
SN
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaatataatattccagtggaagcggcactagaagtcattggaggcaagtggaaa
gtcgttattctttgccacttaattaaagggacaaagcgccctggagaattaaaaagaatt
atgccgcgcgttacgcaaaaagtattaacgcagcagcttcgagaacttgaagcagacggc
atcattgttagaaaaatgtacaatgaaatgccgcctcgagtagaatactctttaacagat
tacggatggtctttaaaaagcattcttgattcattatgctcttggggagaacatcatatt
gaaaaaacgtatcctgataaagaagctgtacttatgcagcctgtagaagaagtcactgtt
tctaattaa

DBGET integrated database retrieval system