KEGG   Bacillus megaterium DSM 319: BMD_0794Help
Entry
BMD_0794          CDS       T01219                                 

Definition
(GenBank) Major Facilitator family transporter
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Motif
Other DBs
NCBI-ProteinID: ADF37656
UniProt: D5DB05
Position
768582..769781
Genome map
AA seq 399 aa AA seqDB search
MNTLSQTQQSKKSGALPLLALAISAFGIGTTEFVPVGLLSSLADDLNISITLAGLLISGY
AMGVAFGAPVLTALTSKMSRKSLLMLLMVIFIVGNSVAALSTSFGLLLIARIITAFSHGI
FFSIGATIAADLVPEDKRASAIALMFTGLTVATVTGVPLGTFIGQAFGWRATFWGVALLG
VIAIIASALLVPKNLKEAPPAKFSDQLKILKNGPLLLSFAITALGYGGTFVAYTYLAPIL
EKLTGYAPSAVSILLLVYGVAVAIGNTIGGKAANKNPLKALFWMFLIQAVILVILSFTAS
FKVAGTITIFAMGLLAFMNVPGLQVLVVNLAEKYVPSAVNVASALNIAAFNVGIAIGSFV
GGLIVDSIGLVHTPWIGGVMVLGAVLLTAWSRSIETKAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacactttcacaaacacaacaaagtaaaaaaagcggtgctttgccgctattagcg
ctagctattagcgcctttggaatcgggactacagagtttgttccagtaggtttattatca
tcgcttgcagatgatttaaatatttccattacactagcagggttattaatttcaggatac
gcaatgggagttgcatttggagctcccgtattaacagctttaacaagtaaaatgagcaga
aaatcactgttgatgctattgatggttatttttatcgtaggaaactcagtagcagcttta
tcaacaagctttgggctgctgcttatagcacgaattattactgcattttcacacgggatt
ttcttttctatcggtgcgactatcgctgctgatttagtgccagaagataagcgagcaagt
gccattgctttaatgtttacaggtttaacagttgcaacggttacaggtgttccgcttggt
acatttatcggacaagctttcggttggagagcaacattttggggagtagcgttacttggg
gttattgccattattgcaagtgctcttttagtacctaaaaacttaaaggaagcgccgccg
gcaaagtttagtgatcaattgaaaattttgaaaaacgggccgcttttactatcgtttgct
attactgccttaggatatggcggaacgtttgtagcttatacgtatttagcacctattctt
gaaaaactaacaggatacgcaccaagcgcggttagtatcttactgctggtatacggcgta
gcagtagccatcggaaatacgatcggaggaaaagctgcgaataaaaacccgttaaaagca
ttattttggatgtttttaattcaagcagttatcttagttattttatcgtttactgcatcg
tttaaagtagcgggaacgattacgatttttgccatgggcttattggcatttatgaacgta
cctggacttcaagtgctggtcgtgaacttagctgaaaagtatgttccttcagcagtgaac
gtagcctctgcgcttaatattgctgcatttaacgttggaattgctattggttcttttgta
ggcggcctgattgttgattcgattggtcttgttcatactccttggattggaggagtaatg
gttttaggagcggtcttattaacagcatggagccgctcaatagaaacaaaagcaaaataa

DBGET integrated database retrieval system