KEGG   Bacillus megaterium DSM 319: BMD_0795Help
Entry
BMD_0795          CDS       T01219                                 

Definition
(GenBank) luciferase-like monooxygenase
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase Luciferase_3H
Motif
Other DBs
NCBI-ProteinID: ADF37657
UniProt: D5DB06
Position
769839..770795
Genome map
AA seq 318 aa AA seqDB search
MTTFQHHKAYRRMYKENELTLGLHMPLENYQYATPTMEKQVELTQLAEQYGFTSLWFRDV
LLQDPSFGDPATGQIYDMLIYLTYLASQTKEIALSTSAIVLPLRHPLRVAKEMATIDQLF
PERLIMGVSSGDRQADFRGLGIPHEERGKRFSEAFHYLEEALNKEFPSIESALGSIQGAN
VVPKPTKRIPTIITGYSQQNMEWFAQYGDGWMYYPRHPHFQAEAITQWRKLVDIYHPGVF
KPFTQPMHLDLAEDPNEMPTPIRLGFRAGRNTLIELLSIYKEIGVNHLFFALFDSKRPAE
EVIHELGEEVLPHFPSHM
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgactacatttcaacatcataaggcgtatcgtcgtatgtacaaggagaatgagttaacg
ttaggtttgcatatgccgcttgaaaattatcaatatgccacgcctacgatggagaaacaa
gtagagctcacgcagcttgcagaacaatatggatttacaagcttatggttccgcgatgtc
cttcttcaagatccatcatttggcgatccagccacgggtcaaatttatgatatgcttatt
tatttgacgtatctggccagtcaaacaaaagaaattgctcttagtacatctgctattgtg
ctgcctttgcgccatccgcttcgcgtagccaaagaaatggcaaccattgatcagcttttt
cctgagcgtttgattatgggcgtgtcttctggagaccgtcaagcagattttcgagggtta
ggtattcctcatgaagaaagaggaaagcgattttcagaggcttttcattatttagaagaa
gcgttaaataaagaatttccatctatcgagtctgctttgggatccattcaaggagcaaat
gtcgttcctaagccaacgaaacgtattccaacgataatcacgggatacagtcagcaaaat
atggagtggtttgcacagtatggggacggctggatgtattatcctcgtcatccccatttt
caagcagaagctattacacaatggaggaaactggttgatatctatcatccaggcgttttt
aaaccttttacacaacctatgcatctagatttggcagaagatccaaatgaaatgccaacg
ccaattcgtttaggatttcgagcaggtcgtaatacattaattgaacttctttctatttat
aaagaaataggagttaatcatctcttttttgctctttttgatagcaagcgtccggctgaa
gaagtcatacatgagcttggtgaagaagtgcttccgcattttccgtctcatatgtag

DBGET integrated database retrieval system