KEGG   Bacillus megaterium DSM 319: BMD_0800Help
Entry
BMD_0800          CDS       T01219                                 

Gene name
mdcD
Definition
(GenBank) malonate decarboxylase, beta/gamma subunit
  KO
K13932  malonate decarboxylase beta subunit [EC:4.1.1.87]
Organism
bmd  Bacillus megaterium DSM 319
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BMD_0800 (mdcD)
Enzymes [BR:bmd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.87  malonyl-S-ACP decarboxylase
     BMD_0800 (mdcD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MdcE Carboxyl_trans DUF5618
Motif
Other DBs
NCBI-ProteinID: ADF37662
UniProt: D5DB11
Position
775009..776709
Genome map
AA seq 566 aa AA seqDB search
MGVNNQSFIELNGRERAQAILDQGTFCELLGPFDGIESPHLPKQNIVPQSDDGVIIAGGL
IAGEPAVVISIEGGFQGGGIGEVSGAKVAGALELALNNHKKGVPVRPVFLFDTGGVRLQE
ANYGLLSISEIGSAVVALREHTPVVGVISGNVGCFGGMSITASLFSYLIMTKEARFGLNG
PEVIEQEAGVEEFDARDRSLIWKTIGGIQRYETGFADTLAQDDVKAIQRAVQETFQKKGK
VTSKTEQVDFYRHLLSKVDPSEKLAPDQFQELYNTTKNEPIPSTVSYSLNEVPGNMPNSR
GRVWINALINDEEADFEIPSVLYKDALLGREKVRYISVVPNPYNRFLRARKGEVGLDEGW
AIAKHVREIIKEDRNQSPRPIIAIVDVPSQAYGYHEELLGIHYACGAAADAYAAARLAGH
PVITLIVGKAISGAFLAHGYQSNRIVALKDEGVNVHAMSKQSAARITKRNIKELEEASKK
VPSMAYDIESFASLGALYELVSGIQAEQPTERDVQTIQDILTGAVEDVCREGVYDLSTRL
YSEQARKEGRKASLLVRDELEKQWNI
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaataatcaaagctttattgagttaaatggaagagaacgagcgcaggccatc
ttagatcaaggaacattctgtgagctgcttggcccttttgacggaatcgaatctcctcat
ttacctaagcaaaatattgttcctcaaagcgatgatggtgtcattatagcaggtgggctg
atagcaggagagccagccgttgtcatttcaatagaaggagggtttcaagggggaggcatt
ggtgaagtatcgggagctaaagttgcaggagctttagaactagcccttaataatcacaaa
aaaggtgttcctgttagacctgtttttctattcgatacaggaggagtaaggctccaagaa
gcgaattatggacttttgtcgatatctgaaattggctcagctgtggttgctttgcgtgag
catacacctgttgttggagttatttcaggaaatgtaggctgctttggaggaatgtccatc
actgcttcactctttagttatctcattatgacaaaagaagcaaggtttggccttaacggc
cctgaagtgatcgaacaagaagcaggggttgaagagtttgatgcaagagaccgaagctta
atctggaaaacgattggcggtattcaacgctatgaaaccgggtttgcagataccttagca
caggatgatgtcaaggctattcaacgagcggttcaagagacgtttcagaagaaaggaaaa
gtaactagtaaaacagaacaagtagatttttacagacatttgcttagtaaggttgatcct
tcagaaaaactggctcctgatcagtttcaagaattgtataacacaacaaaaaatgaacct
atcccttcaacagtctcttactcgctgaatgaagttccaggtaacatgcccaacagccgc
ggtcgcgtgtggatcaacgccttaataaatgatgaagaagcagattttgaaattccttcc
gttctttataaagacgcattgctaggaagagaaaaggtccgatatatatcggttgtacct
aatccttataatcgtttcttacgtgcacgaaaaggggaagtaggactagatgaaggctgg
gcaattgccaagcacgttcgtgaaataataaaagaagatcgaaatcaatctcctcggcct
ataatcgccattgtggacgtaccgagtcaagcgtatggctatcatgaagaacttctaggt
attcactatgcttgcggtgctgcggctgatgcttatgcagcagcgcgcttagcaggtcat
ccggttattacgttaattgtcggaaaagcaatttcaggagcatttctggctcatggatac
caatcaaatcgaattgtggctttaaaagacgaaggagtgaatgttcacgccatgtccaaa
cagtcggcagcgcgcattactaaaagaaatataaaagaacttgaagaagcttcaaagaaa
gtcccgtccatggcttatgatattgaatcttttgcctcacttggcgctttatatgagctg
gttagcggtattcaagcagagcagcccacagagcgcgacgttcaaacgattcaagatatt
ttgactggagcagtagaagatgtatgccgtgaaggtgtgtacgatttaagcacccggcta
tacagtgagcaagcaaggaaggaagggcgaaaagcttctttattagtaagagatgagttg
gaaaaacaatggaatatatag

DBGET integrated database retrieval system