KEGG   Bacillus megaterium DSM 319: BMD_0801Help
Entry
BMD_0801          CDS       T01219                                 

Gene name
mdcG
Definition
(GenBank) holo-ACP synthase, malonate decarboxylase-specific
  KO
K13934  phosphoribosyl-dephospho-CoA transferase [EC:2.7.7.66]
Organism
bmd  Bacillus megaterium DSM 319
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BMD_0801 (mdcG)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.66  malonate decarboxylase holo-[acyl-carrier protein] synthase
     BMD_0801 (mdcG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MdcG
Motif
Other DBs
NCBI-ProteinID: ADF37663
UniProt: D5DB12
Position
776697..777305
Genome map
AA seq 202 aa AA seqDB search
MEYIAHDLLQLKEEAKLISYTPIPDWVEHSLGKAPFVVVRRAVQRDSLIPVGVRGERRNQ
RFGAFVSEQAVKQRIRPEDLVSIFQNGHFRNMPATGALKEVAIILKDFAWGPTGSVGFEF
ASGAEVVTTTSDLDILIRLSSYLSVEQAQLIVNQLKECPVSVDVQVETEKGAFSLVEYAR
GEKTLLLRTVYGPSLVKLNQLV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaatatatagctcatgatttgcttcagttaaaagaggaagcaaagcttatcagttat
acacctatccctgattgggtggagcattctttagggaaggctccgtttgtcgttgtaagg
cgggctgttcaacgagatagcctgatacctgttggagtaagaggagaaagaaggaatcag
cgttttggagcatttgtatctgagcaggccgttaaacaaagaattaggccggaagatctc
gtttctatttttcaaaacggccactttagaaacatgccagccacaggtgctttaaaagaa
gttgctattattttaaaagattttgcgtggggaccaaccggcagtgtgggattcgaattt
gcaagtggtgccgaagttgttacaacaactagtgatttggatatacttattcgcctttct
tcttatttgtcggtggaacaagcgcaactgatagttaatcagttaaaagagtgtccagtt
tctgtagatgtacaggtagaaacagaaaaaggagcattttctctggtggaatatgcaagg
ggagaaaagacgctgcttctgcgtactgtatatggaccttccttagtaaaactgaatcaa
ttagtataa

DBGET integrated database retrieval system