KEGG   Bacillus megaterium DSM 319: BMD_0805Help
Entry
BMD_0805          CDS       T01219                                 

Gene name
glnT
Definition
(GenBank) sodium/glutamine symporter GlnT
  KO
K11626  putative sodium/glutamine symporter
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMD_0805 (glnT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_Ala_symp DUF478
Motif
Other DBs
NCBI-ProteinID: ADF37667
UniProt: D5DB16
Position
780919..782328
Genome map
AA seq 469 aa AA seqDB search
MISVINDFFWSNLLIILLVSIGIYFTIRSRFLQFRMLKEMVLVLKEGRAAKGGGVSPFQA
FCISMAARVGTGNITGIAIAIALGGPGAVFWMWIIAIIGSVSSFVESTLAQIYKVKGSNG
FRGGPAYYMEKGLNKRWMGGLFAVLITLSFGLVFNAVQSNTITLAFENSFGTSRLLVGII
MTVIFAVIIFGGIKRIAKISEYIVVVLAVLYIGMALFIIFKNIDQMPAVLSLIVKNAFGF
EQALGGSIGATLINGVKRGLFSNEAGMGSAPNAAATAVTSHPVKQGLIQAFGVLTDTLVI
CTSTAFIVLLSPAYKQGLSGIELTQASLSTHIGSWASGFLAIMVFLFAFSTLIGNYYYGE
TNIEFLNSNKLWLWSYRVSVLAMVIFGSIAQLQLVWNLADLFMGMMVVVNLIAIFLLSKV
AFSALHDYTQQKKEGKNPVFYRDALENNQNIECWERESTPPPSEKENII
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgattagcgtcatcaacgattttttttggtcgaatttattaattattttacttgtatca
attggtatttattttacgattcgctctcgttttttgcagtttcgcatgttgaaagaaatg
gtacttgttttgaaagaaggacgagcggctaaaggtggaggagtctctccgtttcaagct
ttttgcataagcatggcagctcgagtaggaacgggcaatattacagggatagcgattgct
attgcacttggtggcccgggtgctgtattttggatgtggattattgccattatcggttca
gtatcaagttttgtagaaagtacactcgctcaaatttataaagtaaaaggatcaaacggg
tttcgaggaggacccgcttattatatggaaaaagggttaaataaaaggtggatgggcggg
ctatttgctgtactcattacactatcatttggcctggtgtttaacgctgtgcagtctaat
acgattacgctagcatttgagaactcttttggaacgagccgcttgttggttgggattatt
atgacagttatatttgcagtaattatttttggcggaatcaaacgcatcgccaagatatcg
gaatacatcgtggtcgtattagccgttttatacattggaatggctctgtttattatcttt
aaaaatattgatcaaatgcctgcggttctatctctaattgtgaaaaatgcatttggattt
gaacaggcgcttggggggtcaattggtgcaacgttaatcaacggagtaaagcgcggactg
ttttccaatgaagcaggaatgggaagtgctcccaacgccgcggcaactgcagtgacgagt
catccagttaaacaaggtcttatccaagcatttggtgtcttgacggatacactcgtgatt
tgtacaagcacagcatttatcgttctcttatcccccgcctataagcagggactaagcggc
attgaactaacgcaggcttctcttagtacccatatcggctcttgggcatcagggttttta
gctatcatggtatttctatttgcttttagtacgttaattggcaattattattatggagaa
acgaatattgagtttttaaattcaaataagttgtggctttggtcttatcgtgtaagtgtt
ttggcgatggttatttttggatcgatcgctcagcttcagcttgtatggaatttggcagac
ttatttatggggatgatggtagtcgtgaacttgattgctatttttctattatcgaaagtg
gcattttccgccttgcatgactatactcagcaaaaaaaggaaggaaaaaatccagtcttt
tatagagatgcgttagaaaacaatcaaaatatcgaatgttgggaaagagaatctactcca
cccccttctgaaaaagagaatattatctaa

DBGET integrated database retrieval system