KEGG   Bacillus megaterium DSM 319: BMD_0818Help
Entry
BMD_0818          CDS       T01219                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Yip1 DUF1282 DUF2070 DUF4514
Motif
Other DBs
NCBI-ProteinID: ADF37680
UniProt: D5DB29
Position
797603..798289
Genome map
AA seq 228 aa AA seqDB search
MSTEVNVSSEIQEKGKPSIFGFITSPVVQFEKMKSSPVIWGPLLLILILTAATTILAVYT
PQGQEALQQQKEAGIEVNSTFSMIGGAVGGVIAIVATLAFTSLILFLIAKLGTGKTTYRQ
MFSLNLFVTFITVIGQLINTGVAALAHTSANVTSLNGMVGAKGAMGGVFTSIEIFSIWGL
ILTAVGLQKVANVSKVVSIITVIILFILGAAISGVGGAASEALKGAGL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaagttaacgtatcttcggaaatccaagagaaaggaaagccctctattttt
ggttttattacgagtccagttgtacagtttgagaaaatgaaaagcagcccggtcatttgg
ggacctcttttacttatcctcatcttaacagctgcaacaacgattctagctgtctatacc
cctcagggacaagaggccctgcagcagcaaaaagaagctggcattgaagtgaattcaaca
tttagtatgatcggcggagcggttggaggagtgattgcaatagttgctacactggcattc
acgagtttaattttgtttttaattgcaaagttagggactggaaaaacaacttaccgccaa
atgtttagcttaaatttgtttgttacgttcatcacagtaatcggtcaactaattaatacg
ggagtagctgcactagcacatacttcagctaatgtgacttcgttaaatggaatggttggt
gcgaaaggtgctatgggaggagtgtttacttccattgaaatcttttctatctggggactt
attctgacagcagtaggactacaaaaagtggcaaatgtatcaaaagttgtttctattatt
acagtgattattttattcatcttaggagccgctatttcaggagttggaggagctgcttca
gaagcgcttaaaggagcagggttgtaa

DBGET integrated database retrieval system