KEGG   Bacillus megaterium DSM 319: BMD_0826Help
Entry
BMD_0826          CDS       T01219                                 

Definition
(GenBank) nucleoside transporter, NupC family
  KO
K16323  purine nucleoside transport protein
Organism
bmd  Bacillus megaterium DSM 319
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmd02000]
    BMD_0826
Transporters [BR:bmd02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BMD_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nucleos_tra2_C Nucleos_tra2_N TMEM173
Motif
Other DBs
NCBI-ProteinID: ADF37688
UniProt: D5DB37
Position
805527..806720
Genome map
AA seq 397 aa AA seqDB search
MYFLLNLLGVFVVMGVVFLCSPKKKEIKWRPIASLLVVEVLITWFMLGTSIGTWIINKIA
SFFTWLISCANDGIAFAFPSVMGNETVDFFFSALLPIIFVVTFFDILSYFGILTWIIDKV
GWVISKVSRLPKLESFFAIQMMFLGNTEALAVIRNQLSVLKDNRLLTFGIMSMSSISGSI
IGAYLTMVPATYVFTAIPLNCLNALILVSLLNPVHVTKEEDMIYVPPKSEKKDFFSTISN
SMLVGMNMVIVILAMVIGYVALTSALNGILGVIVDGLTVQKIFSYIFSPFAFLLGLTGHD
AMYVAQLMGIKLATNEFVAMMDLKKNLDTLPPHTIAVATTFLTSFANFSTVGMIYGTYNS
TLSEGKSTIIGKNVWKLLVSGIAVSLLSAMIVGLFVW
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtactttttattaaatttattaggcgtttttgtcgtaatgggtgtcgtctttttatgt
tctcctaaaaagaaagagataaagtggcgtccaattgcttcactgttagtcgttgaagtc
ctcattacttggtttatgttaggaacttcaatcggaacatggattattaataagattgct
tcgttctttacttggctaatttcctgtgctaacgatggaattgcttttgcgttcccatct
gtaatgggaaatgaaacggttgactttttcttcagtgcattactgcctatcatctttgtc
gtgacattttttgatattttatcttactttggtattttaacgtggattattgataaagta
ggctgggtcatttcgaaagtttctcgtttgcctaaattagaaagctttttcgctattcaa
atgatgtttttaggaaatacagaagcattagcggttattcgtaatcagctttctgtgtta
aaagacaaccgtttgcttacgtttggaattatgagtatgagcagtattagcggatctatt
atcggtgcttatttaacgatggttcccgctacgtacgtgtttacagcaattccactgaac
tgtttaaacgcgcttattttagtgagcttattgaatccagttcatgttacaaaagaagaa
gatatgatttacgtaccgccaaagtcggagaaaaaagactttttctctaccatttcaaac
agtatgttagtcggaatgaacatggttattgttattttagcgatggttattggatatgta
gctcttacatctgcgcttaacggtattttaggcgttatcgtagacggcttgactgtgcaa
aagattttctcttatatctttagtccattcgcatttttactagggctaacgggacatgat
gcaatgtacgtagctcagctgatgggtatcaagctagcaacaaatgaattcgtggcaatg
atggatttgaagaaaaatctagatacacttccaccgcatacgattgcagttgctacaaca
ttcttaacatcttttgctaacttcagtacggtaggtatgatttatgggacgtataattct
acgttatcagaaggtaaatcaacgattattggaaaaaacgtatggaaactgcttgtgagc
ggtatcgctgtttcgttattaagtgctatgattgttggattgtttgtttggtaa

DBGET integrated database retrieval system