KEGG   Bacillus megaterium DSM 319: BMD_0830Help
Entry
BMD_0830          CDS       T01219                                 

Gene name
bioA
Definition
(GenBank) adenosylmethionine-8-amino-7-oxononanoate transaminase
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00780  Biotin metabolism
bmd01100  Metabolic pathways
Module
bmd_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BMD_0830 (bioA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmd01007]
    BMD_0830 (bioA)
Enzymes [BR:bmd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     BMD_0830 (bioA)
Amino acid related enzymes [BR:bmd01007]
 Aminotransferase (transaminase)
  Class III
   BMD_0830 (bioA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Dpoe2NT
Motif
Other DBs
NCBI-ProteinID: ADF37692
UniProt: D5DB41
Position
809907..811280
Genome map
AA seq 457 aa AA seqDB search
MPYQKAELEKWDKEYVWHPFTQMKAYRQSNPLIIERGEGSYLYDVEGNKYLDGYASLWVN
VHGHNDPELNTALHIQVEKLAHSTLLGSANVPSILLAKKLAEITPGSLSKVFYSDTGSAA
VEIALKIAYQYWQNLDSVKYKNKSKFISLNEAYHGDTIGAVSVGGMDLFHRIFKPLLFER
IPAPSPYTYRMEGFETEEQASAYCIHQLEKLLQNKGEEVAGLIIEPLVQGAAGIITHPPG
FLKQVERLCKAHGVLLICDEVAVGFGRTGTMFACEQEDVVPDIMCVGKGITGGYMPLAAT
LTSEKIFNAFLAHPDENKTFFHGHTYTGNQLACAVALKNIELIEERELIRSVKEKEKVFK
RYLLKLYELPNVGDIRQRGLMAGIEIVKDRQTKSIFGDKKVMGDIILAARQKGLIIRELG
PVITMMPILSMTNEELKTMVEIVYESIKEVIARHTVS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtatcaaaaagctgagctggagaaatgggataaagaatatgtatggcatccgttt
acacaaatgaaagcttatcgtcaatcgaatcctcttattattgaaagaggagaaggaagc
tatttatatgatgtagagggaaacaaatatttagatggatacgcttctctatgggtgaac
gtgcatggacataatgatccggaattaaatacagctttacatatacaagtggaaaaatta
gcgcattctacgctgcttggatccgcaaacgttccatccattttgttagccaaaaagcta
gcggaaattactcctggcagcttatcgaaagtcttctactctgatacaggctccgccgct
gtcgaaattgcgttgaaaattgcctatcaatattggcaaaatctcgactctgtaaagtac
aaaaacaaaagtaaatttatctcattgaatgaggcatatcacggagatacaattggggca
gtcagtgtgggaggcatggatttatttcatcgcatctttaagcctttgctgtttgaacga
attcctgcaccttctccttatacttaccgtatggaaggatttgaaacggaagagcaagct
tcagcttactgtattcaccagctagagaagctcttgcagaacaaaggggaagaagtagcc
gggttgattattgaaccgcttgtgcaaggagcagcgggtattattacccatcctcccggc
tttttaaaacaagtagagcggctgtgcaaagcgcacggggtattgctcatttgtgacgaa
gtagcggttggatttggacgaacaggaacgatgtttgcatgtgaacaagaagatgtagta
ccagacattatgtgtgtaggaaaagggataacaggaggatatatgccgcttgctgctacg
ttaacaagcgaaaagatatttaatgcttttttagctcatccggatgaaaataaaacgttc
ttccatggccatacgtatacgggaaatcaattagcctgtgcagtagcgcttaaaaatatt
gaactgatagaagaaagagaattaatccgtagtgtaaaagaaaaggaaaaagtttttaaa
cgctatctattaaagctttatgaactgcctaatgtgggagacattagacaacgaggttta
atggcaggaatcgagattgtgaaagaccgtcaaacaaaatcgatttttggagataaaaaa
gtgatgggagacattattttagccgctcgccaaaaaggtttaattattagagagctaggt
cctgtgattacgatgatgcctattctttcaatgacaaacgaagaattaaaaacaatggtt
gaaattgtatatgaatcaattaaagaagtaatcgcacgtcatacagtgagttaa

DBGET integrated database retrieval system