KEGG   Bacillus megaterium DSM 319: BMD_0835Help
Entry
BMD_0835          CDS       T01219                                 

Gene name
dctS
Definition
(GenBank) two-component sensor histidine kinase DctS
  KO
K11691  two-component system, CitB family, sensor histidine kinase DctS [EC:2.7.13.3]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd02020  Two-component system
Module
bmd_M00489  DctS-DctR (C4-dicarboxylate transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMD_0835 (dctS)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BMD_0835 (dctS)
Protein kinases [BR:bmd01001]
 Histidine kinases
  CitB family [OT]
   BMD_0835 (dctS)
Two-component system [BR:bmd02022]
 CitB family
  DctS-DctR [MD:M00489]
   BMD_0835 (dctS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c sCache_3_2 SPOB_a HATPase_c_5 dCache_3 HATPase_c_3 PAS_10 PAS PAS_9 sCache_3_3 PAS_7 HATPase_c_2 sCache_2 PAS_8 DUF2659
Motif
Other DBs
NCBI-ProteinID: ADF37697
UniProt: D5DB46
Position
815597..817162
Genome map
AA seq 521 aa AA seqDB search
MRLSMQTKMTGLIFFIVAFSLFLASIVVINNFVQSKENDLEQRALITSRTVAEMPEIREK
IEKDSKNINQIVEPIRIIHGAYYVVVMNMNHERLSHPLQSMIGKTSKGDDEGQAFAEHTY
TDKAKGEGGMVIRSFVPVVNDQHEQVGVVVSGYLLPKFTEVILSLKKEIFLISGLALFFG
GWGAWALASRIKKEMFELEPHEIARLFVERTETFNAMHEGVIAIDKEENITIFNHKAKIM
MDVPDEVIGKKIYDVIPDTRLPEILQLNQPVYNRELQVRNLNILSNRVPIKVNNHTVGAV
AVFQDRTEVKKLAEELTGVKSFVSALRVQNHEYMNKLHTIAGLIQLGNKDKALQYVFQVS
EQQEELTQFLHKHIKDESISGLLLSKVSRAKELGIELAIDRHSKLHSFPPYLDHHDFVII
IGNLIENAFDSYQHMERRERKIYISMEQNDGILSILVEDNGCGMNEDQVARIFDEGFSTK
AKENRGIGLHLVKQIVEKGNGQIEVESELDVGTTFIITFFL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttatcgatgcaaacgaaaatgacggggttaatcttttttatcgtggccttttcg
ttgtttttagcaagtatcgtggtgattaataattttgtacagtcaaaagaaaatgattta
gagcaaagggctttaatcacttcgagaacagttgctgaaatgcctgaaattcgagaaaaa
attgaaaaagatagtaagaacattaatcaaattgtagagccgattcgcattattcacggt
gcttattatgtagtggttatgaatatgaatcatgaacgtttgtctcaccctttgcaaagc
atgattggaaaaacctctaaaggagatgatgagggacaggcgtttgcagaacatacctat
accgataaagcaaaaggagaaggcggaatggtcattcgctcttttgtgcccgttgtaaac
gatcagcatgaacaagtaggagtggttgtctcaggctatcttcttccgaaatttacagag
gtcattttaagtttaaaaaaagaaatctttcttatctcaggtcttgctcttttttttgga
ggatggggagcgtgggcgcttgcatctcgtatcaaaaaagagatgtttgaacttgaacct
catgaaattgctcgtttgttcgtagaacgaacggagacctttaatgccatgcatgaagga
gtcattgccattgataaagaggagaacatcactatttttaatcataaagcgaaaattatg
atggatgtacccgatgaggtaattggaaaaaagatctatgatgtgattccagatacaagg
cttccagaaattctgcagcttaatcagcctgtttataatcgagagcttcaagttcgaaat
ttgaatattttaagcaatcgtgtgccgattaaggttaataatcacacagtcggtgcggtc
gctgtttttcaagacagaacggaagttaaaaaattagctgaagagttaacaggagttaaa
tcatttgtaagcgctcttagagttcaaaaccatgaatacatgaataaacttcatacgatt
gcagggcttatccaacttggaaataaagacaaggctcttcagtatgtttttcaagtgtct
gaacagcaagaagagctcacccaatttcttcataagcatattaaagatgaaagtatatcg
ggattgctgttgagcaaagtcagccgtgccaaagaacttggaattgagttagctatcgat
cgccacagcaagcttcactcatttcctccttacttagatcatcatgattttgtgattatt
attggtaacttaattgagaacgcttttgattcgtatcaacatatggagcgtcgtgaacgg
aagatctatataagtatggaacaaaatgacggcattctttctatattagttgaagataac
gggtgtggcatgaatgaggatcaggtagcgagaatctttgatgaaggtttttcaaccaaa
gcaaaggaaaatagaggaattggtttgcatttagtaaaacaaattgttgaaaaaggaaac
ggtcagatcgaagtagagtcagaattagatgttggaacgacttttatcattacattcttt
ttatag

DBGET integrated database retrieval system