KEGG   Bacillus megaterium DSM 319: BMD_0837Help
Entry
BMD_0837          CDS       T01219                                 

Gene name
glcU
Definition
(GenBank) glucose uptake protein
  KO
K05340  glucose uptake protein
Organism
bmd  Bacillus megaterium DSM 319
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmd02000]
    BMD_0837 (glcU)
Transporters [BR:bmd02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BMD_0837 (glcU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_transport EamA Glucos_trans_II TMEM144 Ureide_permease V_ATPase_I DUF1129 TIM21
Motif
Other DBs
NCBI-ProteinID: ADF37699
UniProt: D5DB48
Position
818081..818941
Genome map
AA seq 286 aa AA seqDB search
MDIFLAVLPAIFWGSIVLFNVKLGGGPYSQTLGTTLGALIFSIGIYIFVHPTFTPLIFGV
GVVSGLFWAVGQSNQLKSIDLIGVSKTMPISTGLQLVSTSLFGVIVFHEWSTKTSIILGV
LALIFIIVGIVLASLQSKEEKEAEEGKGNFKKGIVILLISTVGYLVYVVVARLFNVDGWS
ALLPQAIGMVIGGVLLTFKHKPFNKYAIRNIIPGLIWAAGNMFLFISQPKVGVATSFSLS
QMGIVISTLGGIIILGEKKTKRQLVGIIIGIILIIIAGVMLGLAKS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggacatatttttagccgtcttaccagccatattttggggaagcattgtgctttttaat
gtgaaactaggcggaggaccttatagtcaaacgcttggaaccacattgggagctttaatt
ttctccatcggtatttatatttttgtacaccctacgtttacacctttaatctttggggtt
ggagttgtttcggggctattttgggcagttggacaaagtaatcagctgaaaagtattgat
ttaattggagtttctaaaacgatgcctatttcaacggggcttcagttagtttccacttca
ttatttggagtaattgtgtttcacgagtggtctacaaaaacttcaatcattcttggtgtg
ctcgctcttatctttattattgtagggattgttttagcatcacttcaaagcaaagaagag
aaagaggctgaagaaggaaaaggaaacttcaaaaaaggaattgttattttattaatttca
accgttggttatttagtttatgttgtagtagcccgtctatttaatgtagacggatggtcg
gctttattacctcaagcaattggtatggttattggaggagtattgctgacgttcaagcat
aagccatttaataaatatgcaattcgcaacattatcccaggtcttatttgggccgctggt
aatatgtttttattcatctcacaacctaaagtaggcgtagcgacaagcttttcgctttct
caaatgggaatcgtcatttcaacattaggcgggatcattattttaggtgagaagaaaacg
aagcgtcagttagttgggattattattgggattatactgatcatcatagcaggagtcatg
ttagggctcgccaaaagctaa

DBGET integrated database retrieval system