KEGG   Bacillus megaterium DSM 319: BMD_0842Help
Entry
BMD_0842          CDS       T01219                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3169 DUF2178 EI24 DUF3784 Cytomega_TRL10 Peptidase_U4 TMEM40 DUF1980
Motif
Other DBs
NCBI-ProteinID: ADF37704
UniProt: D5DB53
Position
complement(821871..822341)
Genome map
AA seq 156 aa AA seqDB search
MLSNVIKSYLLNVVSLLCVGWFLYDFLSLNIQFSEVMTDPEPPWEITMSIGSFASLIVLL
IVSFFYYRARKKTKNVSPLLFPFEFAEEDEREKMITAEACKKAFVFLLFSIPIGAILIAF
YPLLPNSFSFYPIAVLLLLSLVQLTVYYVSISKIYR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtaatgttattaaatcttatttgttgaatgtagtgtctctgttgtgcgtaggt
tggtttttatatgattttttaagcctaaatattcaatttagtgaagttatgaccgaccct
gaacccccgtgggaaattactatgtctataggctcttttgcttctttaattgttctttta
atcgtctcatttttttactaccgggcgcgtaaaaagacgaagaacgtttcgcctttatta
tttccttttgaatttgcagaagaagatgaacgtgaaaagatgataacagcagaagcttgt
aaaaaagcctttgtttttctcctattttctattcctataggtgctatattaatagctttt
tatccgctgttacctaattcttttagcttctatcccattgccgttcttttacttctttct
cttgtgcagttaacagtttattacgtatcaattagtaagatttatcggtga

DBGET integrated database retrieval system