KEGG   Bacillus megaterium DSM 319: BMD_0845Help
Entry
BMD_0845          CDS       T01219                                 

Definition
(GenBank) Sulfatase
  KO
K19005  lipoteichoic acid synthase [EC:2.7.8.20]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00561  Glycerolipid metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BMD_0845
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.20  phosphatidylglycerol---membrane-oligosaccharide glycerophosphotransferase
     BMD_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase DUF229 Phosphodiest
Motif
Other DBs
NCBI-ProteinID: ADF37707
UniProt: D5DB56
Position
823274..825202
Genome map
AA seq 642 aa AA seqDB search
MKRIVSKPLHYFILAAVLMWIKSYVAYKTEFNLGVSGVMQQMLLFINPVSSVLIFLGIGL
FFKGKKAGAWILAGSFIMTLLLYSNVLYYRFFNDFVTLPTLLQTSNAGSMGGSIMDLLKA
HDVFYFVDFIIYFFFFFSKKIDWHNEKVSVKNAVTILSLGFMVFSVNLTLAEIDRPQLLS
RTFDRNYLVKYLGAYNYTMYDGVQTAQNSKQRAFASSNDLTNVVNFKNSHYAEPNSVYFG
KAKGKNIIKIHLESFQSFLIDYKLNGQEVTPFLNSLAHGNDFTYFDNFFHQTGQGKTSDA
ELMMDNSLYGLPQGSAFVLKGSNTYQAAPAILDQKAGYTSAVLHGDYKTFWNRNEIYKQF
GVDKFFDASYYNMTGENKINYGLKDKPFFKESVPMLQSLPQPFYAHLITLTNHFPFLLGN
NEASIQPANTGDATVDRYFQTARYLDESLQSFFQELKASGLYDNSVIMIYGDHYGISENH
NAAMEKIMGKEITPYENAQLQRVPLFIHVPGVKGGVNHTYGGEIDVVPTLLHLVGIDSKE
FIQFGTDLFSKDHDDVVAFRNGNYVSPRYTLVDGTYYDSKTGQALKENNQMKAYKQKVAK
ELELSDQVLYGDLLRFHKLKDFQTVDPSKYMYGKEETETSAK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaatcgtttctaagccgctgcactatttcatattagccgctgttttaatgtgg
ataaagtcgtatgtggcttataaaactgaatttaacttaggcgtaagcggcgtaatgcag
caaatgctgttgttcataaaccctgtgagttcagtgctgatttttttaggaatcggctta
ttttttaaaggaaagaaagcaggagcttggatccttgcaggcagtttcattatgacgctg
ctgttatacagcaacgttctctattatcgtttttttaacgattttgtaacgcttcccaca
ctgttgcagacaagtaatgcaggaagtatgggcggaagcattatggatttattaaaagca
catgatgttttttattttgttgattttattatttattttttcttcttttttagtaaaaaa
attgactggcataatgaaaaagtatcggttaagaatgctgtaactattctttctttaggg
tttatggttttttctgtaaatttaacattagcagaaattgatcgcccgcagcttctatct
cgaacttttgaccgcaattatctagtaaagtatttaggcgcctataattatacgatgtat
gacggtgttcagactgctcaaaactctaaacagcgagcttttgcaagcagcaatgattta
acaaacgtcgttaattttaaaaacagtcattatgcggagcctaattccgtttattttgga
aaagctaaaggaaaaaatattattaaaattcatttggaatcatttcagtcttttttaatt
gattacaaattaaatggtcaggaagtgacacctttcttaaattcgttggcccatggaaat
gactttacgtattttgataacttctttcatcaaacgggacaaggaaaaacatcagatgct
gagctgatgatggacaactctctatacggccttcctcaaggttctgcctttgtactgaaa
ggaagcaatacgtatcaggcagcaccagctattttggatcaaaaagctggctatacgagc
gctgtgctgcacggagactataagacgttttggaaccgtaacgaaatttacaagcagttc
ggtgtggataagttctttgatgcaagttattacaatatgacgggtgaaaataaaattaat
tatggtttaaaagacaaaccgttctttaaagaatctgttccaatgctgcagtctttacca
cagccgttctatgcgcatttaattacgttaacaaatcattttccatttttacttggaaac
aatgaggcaagcatacagccggctaacacgggcgatgcaacagttgaccgttatttccaa
acggctcgttatttagacgaatcattgcaatctttcttccaagaactgaaagcttctggg
ctttatgataattctgtgattatgatttatggagatcactacggtatttctgaaaatcat
aatgcggcaatggaaaaaataatgggaaaagaaattacgccttatgaaaatgctcagctg
cagcgtgtacctctattcattcacgttcctggagtaaaaggcggagttaatcatacgtac
ggtggagaaattgacgttgtgccaactcttcttcatttagtagggattgacagcaaagag
tttatccaatttggcacagatttattttctaaggatcatgatgatgtagtggcattccgc
aatggcaactacgtatctcctagatatacattagtggatggaacgtattatgattctaag
acgggccaagcccttaaagaaaataatcaaatgaaagcttataaacagaaggtagcgaaa
gaactggagttatctgatcaagtgctttatggagacttgcttcgtttccacaagctgaag
gatttccaaacagtcgacccttcgaaatatatgtacgggaaagaagaaacagaaacttca
gctaaataa

DBGET integrated database retrieval system