KEGG   Bacillus megaterium DSM 319: BMD_0849Help
Entry
BMD_0849          CDS       T01219                                 

Gene name
ybgG
Definition
(GenBank) homocysteine S-methyltransferase
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00270  Cysteine and methionine metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BMD_0849 (ybgG)
Enzymes [BR:bmd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     BMD_0849 (ybgG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans
Motif
Other DBs
NCBI-ProteinID: ADF37711
UniProt: D5DB60
Position
827824..828759
Genome map
AA seq 311 aa AA seqDB search
MNPIQQILHTFPVIVLDGAMATELERYSCDLNDSLWSAKVLMEQPELIKRVHQDYFAAGA
DCAITASYQSTFEGFAKRGLSEAEARELIQASVKIAAESRDEFWHQEENRLNRPKPIVAA
SVGPYGAFLANGSEYTGQYDVTEEELMEFHRPRMKALIEAGADVLACETIPNLMEARAIA
KLLEEFEGAYAWITFSAKDDLHISSGTLISECARYLDSYEQVAALGVNCTPPQYISSLIK
EIKSQTDKPVIVYPNSGEHYDAESKTWNGTSAGETYGCSAHSWYEAGAQLIGGCCRTTPD
DIKGITKWARK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctatccaacaaattttacatacatttcctgtgattgtactagatggtgcaatg
gcaactgaacttgaaagatatagctgtgatttaaacgacagcttatggtctgcaaaagtg
ctgatggagcagccggaactgattaagagagtgcaccaagactactttgcagcaggagct
gactgtgcaattacagcaagttatcaaagcacatttgaaggttttgctaaacgtggactg
agtgaagcagaggctcgcgagttaattcaagcatctgtaaaaattgcggctgaatcaaga
gatgaattttggcaccaagaagagaatcgtcttaatcgtcccaaaccaattgttgccgct
tcggtagggccttacggagcatttttagcaaacggatcggaatatactggacagtatgac
gtaacagaagaagagttaatggaatttcatcgtcctcgtatgaaagcattaattgaagca
ggagcggacgtattagcttgtgaaactattccaaatttaatggaagcaagagccattgcg
aagctgctagaagagtttgaaggagcgtacgcatggattacgttcagcgcaaaagatgac
ctgcacattagcagcggaacattaatctcggagtgtgcacgctatctggattcctatgag
caagtagcggctcttggagttaactgtacgccgcctcaatatatttcttcacttattaaa
gaaattaaatctcaaacggataagccagtcattgtgtatccaaattcaggggagcattat
gatgctgaatctaaaacatggaacgggacatctgctggcgaaacgtatggctgcagcgct
cacagctggtatgaagcaggtgctcagttaatcggagggtgctgtcgtacaactccagat
gatatcaaaggcattacaaaatgggctagaaaataa

DBGET integrated database retrieval system