KEGG   Bacillus megaterium DSM 319: BMD_0854Help
Entry
BMD_0854          CDS       T01219                                 

Gene name
citT
Definition
(GenBank) citrate two-component response regulator CitT
  KO
K11638  two-component system, CitB family, response regulator CitT
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd02020  Two-component system
Module
bmd_M00487  CitS-CitT (magnesium-citrate transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMD_0854 (citT)
Two-component system [BR:bmd02022]
 CitB family
  CitS-CitT [MD:M00487]
   BMD_0854 (citT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HTH_11 HTH_DeoR DUF977 HTH_micro HTH_23 Sigma70_ECF Sigma70_r4 IMPDH HTH_IclR CitT EAP30 HTH_36
Motif
Other DBs
NCBI-ProteinID: ADF37716
UniProt: D5DB65
Position
834598..835269
Genome map
AA seq 223 aa AA seqDB search
MLRVAIAEDDFRIAQVQERFLLEVDGVEVVGKALNAKETLEMLKEKKVDLLLLDIYMPDE
MGTDLLPKIRAQFPHVDVIVVTAATEKNIVEICLRNGVVNYLIKPVMMESFINAIKQYQE
KKELFSTHEEVDQSFIDAYFGHVRTKPKADKSLPSGIDGITLQKSKDILKSIKGITIEEM
GQHMGVSRTTARRYLEYLVSTGECHVEYDYGIIGRPERKYYLA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgttacgagtcgcaattgcagaagacgattttcgaattgctcaagttcaagagcgattt
ttattagaagtagatggtgtggaagttgtaggtaaagcgttgaatgcaaaagagacgctt
gaaatgctaaaggagaagaaagttgatttacttcttttagacatctatatgccagatgaa
atgggaacagatttactgccaaaaatcagagcgcagtttccacacgttgacgttatcgtg
gtaacggctgccaccgaaaaaaacattgtagaaatctgtttgagaaacggcgtcgttaat
tatttgattaagccggttatgatggaatccttcattaatgctattaaacagtatcaagag
aaaaaggaactgtttagtacgcatgaagaagttgatcaatcatttattgatgcgtacttt
ggacatgtcagaacaaagccaaaagcggataaatctcttccttcaggtattgatggtatc
acattacaaaagtcaaaagatattttaaaaagcatcaaaggaattacgatcgaagagatg
gggcagcacatgggagtatctagaacgacagctagacgatatttagagtatctagtatca
actggtgaatgtcacgttgaatatgattatgggattattggacggccagagcgcaagtac
tatttagcgtag

DBGET integrated database retrieval system