KEGG   Bacillus megaterium DSM 319: BMD_0855Help
Entry
BMD_0855          CDS       T01219                                 

Definition
(GenBank) putative lipoprotein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TctC
Motif
Other DBs
NCBI-ProteinID: ADF37717
UniProt: D5DB66
Position
835294..836262
Genome map
AA seq 322 aa AA seqDB search
MIKKLMIVFISVLLVSCSSPSKKDRIEMGEIEIVAAGAKGGGADATVRAIQQVLTEKKIV
KVPVSVSNKIGGQGEEGWKYIKQRKEGNIVSGNSSLLITNNLLGQSQLTYKDFTPLAILT
SEWEVIVVPANSPIYNLKQLIRTLNQSESSMKVGISPRLGNDDHLSFMQLNKKAGVDSSK
LEFFVYNSSHKVIDALVHHQLDVAPMSLSEVKKQYEQGQVRILAVSSPSRLEELKEIPTW
KEAGIDVTFSHWRGLMGPPNMTKEQVAYWNKTVYEMVHTKEWEQLLKDNDLTSFYKNSSG
AKVFLEQQSKLYSDLMGGTNDE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaagctcatgatagtgtttataagtgtattgcttgttagctgttcttctccc
tctaaaaaagaccgtattgagatgggggaaattgaaattgtggcagccggtgcaaaaggc
ggaggagcagatgcaacagtaagagccattcaacaagtgctaacggaaaagaagattgtg
aaggtacccgtttctgttagtaataaaataggtgggcaaggtgaagaaggatggaaatat
attaaacagagaaaagaagggaatattgtttccggaaattccagcttgctgattacaaat
aatttgctagggcaaagtcaattaacctataaagactttactccgctcgctattttaaca
tctgaatgggaggtcatcgtagttcctgctaactctcctatatataatttaaaacagctc
atacgcacgttaaatcaaagtgaatccagcatgaaagtgggaatatcacctcgcttagga
aacgacgatcatttatcgttcatgcagctgaataaaaaagcaggcgtagactcttccaag
cttgagttcttcgtttacaacagcagtcataaagtgatcgatgcgctcgttcaccatcag
ctagatgtagcacctatgtcattatcagaagtgaaaaagcagtatgaacaagggcaggta
agaatactcgctgtttcttctcccagcaggctagaagagttaaaagagatcccaacgtgg
aaagaagcgggaattgacgtaacatttagccattggagaggtctaatgggaccgcctaat
atgaccaaagagcaggtagcatattggaataagacagtgtatgaaatggttcatacaaaa
gaatgggaacaactgcttaaagataacgatttaacctctttttataaaaatagcagtggt
gctaaagtctttcttgaacagcaaagcaagctgtattctgacttaatgggcggaacaaat
gatgaataa

DBGET integrated database retrieval system