KEGG   Bacillus megaterium DSM 319: BMD_0859Help
Entry
BMD_0859          CDS       T01219                                 

Gene name
opuAB
Definition
(GenBank) glycine/betaine ABC transporter, permease protein OpuAB
  KO
K02001  glycine betaine/proline transport system permease protein
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd02010  ABC transporters
Module
bmd_M00208  Glycine betaine/proline transport system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BMD_0859 (opuAB)
Transporters [BR:bmd02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter [MD:M00208] [OT]
    BMD_0859 (opuAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADF37721
UniProt: D5DB70
Position
complement(839619..840464)
Genome map
AA seq 281 aa AA seqDB search
MNSIPKIPVGNWIDHFVTFLNDNIKGFFDVISAIVDGIVSFIVLVLTFPPALILILIVGI
IAWFSSKKWSFTILSMIGLLFILNLGYWQETMDTLALVLTSVLISIIVGIPLGIWASQSE
KTARIITPILDFMQTMPAFVYLIPALFFFGIGVVPGVISSVIFAMPPTIRLTNLGIREVP
ADLVEAANAYGSTTKQKLFKVQLPLATKTIMAGINQSIMLSLSMVVIASLVGAPGLGAEV
YRAVSRLEVGTGFEAGISIVILAIILDRITQYFGNRSNQRA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtattcctaaaattcccgttggcaattggattgaccattttgttacattttta
aatgataatatcaaagggttttttgatgttatttcagctattgtcgatggtattgtaagt
tttattgtactagtgctaacctttcccccagcattaattttaatcttaattgtcggaatc
attgcttggttttcaagtaaaaaatggtcatttactattttatcgatgattggcctgtta
tttattcttaatcttggctactggcaagaaaccatggacacactagccctcgttttaaca
agcgtactgatttcgattatagtaggaattccgttaggcatttgggcatctcaaagcgaa
aagacggctcgaattattacgccaatcttagactttatgcaaacaatgcccgcatttgtt
tatttgattccagcacttttcttctttggaattggtgtggtaccaggtgttatctcatct
gttatctttgcaatgcctccaacgattcgcttaacgaacctaggtattcgtgaagtaccc
gctgacttagtagaagcagcaaatgcctacggttcaacaacaaaacaaaaattatttaaa
gtacagcttccattagctacaaaaacaattatggcaggaattaaccaaagcatcatgcta
tctctttcaatggtcgttattgcctctcttgtaggtgctccgggacttggtgcggaagta
tatcgtgcagtttctcgacttgaagtcggcacgggctttgaagccggaatttcaatcgtt
attttagcgattattttagaccgtattacgcaatattttggaaatcgttcaaaccaacga
gcataa

DBGET integrated database retrieval system