KEGG   Bacillus megaterium DSM 319: BMD_0863Help
Entry
BMD_0863          CDS       T01219                                 

Definition
(GenBank) betaine aldehyde dehydrogenase
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00260  Glycine, serine and threonine metabolism
bmd01100  Metabolic pathways
Module
bmd_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMD_0863
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     BMD_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ADF37725
UniProt: D5DB74
Position
843880..845367
Genome map
AA seq 495 aa AA seqDB search
MDRTAVKTLTLNMYINGEWKKAEKQRPAVNPATGEVIGYAAEGSIEDMKTAIGAAREAFD
SGIWSETSASERAAILFKIADKLEEAKEELAALETMDNGKPYREAEADVEDAAACFRYYA
GLITKPDGQTYSVPAPMQAMVIKEPIGVCGLIVPWNYPLLMSVWKIAPALAAGNTIVFKP
SEVTPVTPTKLFEILESVGLPKGVANLVMGAGDTVGNTLIQDKRVDKISFTGGTVTGKHI
MRQAAENVTKVSLELGGKSPNIIFADADFETAVDYALFGIFAGSGQICAAGSRILVEESI
AERFLERFAERAQKIKVGNGMDQEIEMGPLVSEEHMKKVLKYIEIGKQEGARLVCGGNRI
TSSGLEKGFFVEPTVFSNVTSNMKIVQDEIFGPVVVIQTFKDEKEAIKLANDTEYGLAGS
VFTNDGAKALRVIKKLRAGITWVNTYHFTFNEAPWGGYKQSGIGRGLGTFGLEEFQEVKQ
ININLQVEPIGWFKN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtacagccgttaaaacgttaactttgaatatgtacataaacggagagtggaaa
aaagcagagaagcagcgtcctgctgttaatccagctacaggtgaagtgattggatatgct
gcagaaggcagcatagaagatatgaaaacagcgattggagcagcacgagaagcctttgac
agcggaatttggtctgagacttctgcatctgaaagagcagctatcttatttaaaattgcc
gataagcttgaagaagcgaaagaagaattagcagcgctagaaacaatggataacggaaag
ccctatcgcgaagctgaggctgatgtggaagatgcagctgcttgttttaggtattacgct
ggattaattacaaagccagacggtcaaacgtacagtgttccggcacctatgcaagcaatg
gttataaaagaaccaattggggtgtgcggattgattgtaccttggaattatccgctgttg
atgagcgtgtggaaaattgcacctgctttagctgcaggaaatacgattgtatttaaacct
tctgaagtgacaccggttactcctacaaaactttttgagattttagaaagcgtaggattg
ccaaaaggagtagcaaaccttgttatgggagccggagatactgtgggaaatacgcttatt
caagataagcgtgttgataagatttcctttacaggaggaacggtaactggaaaacacatt
atgcgtcaagcagcagagaatgtaacgaaagtctctttagaacttggaggaaagtcaccg
aacattatatttgctgacgctgattttgaaacagctgtagattatgccttatttggaatt
tttgcagggagcggccaaatttgcgctgcaggttctcgtattttagtagaagaaagcatc
gctgagagatttctcgaacgttttgcagagcgtgctcaaaaaattaaagtaggaaatgga
atggatcaagagattgaaatgggccctcttgtaagtgaagaacatatgaaaaaagtatta
aagtacatcgaaattggaaagcaagaaggcgcccgccttgtatgcggaggcaatcgaatc
accagcagtggattggaaaaaggattctttgtagaacctacggtttttagtaacgttacg
tcaaatatgaaaattgtgcaagatgaaatctttggacccgttgtcgttattcaaacgttt
aaagacgaaaaagaagctattaagcttgcaaatgatacggaatatggtttggcaggcagt
gtgtttacaaacgacggcgcaaaagctcttcgggtgattaaaaagctgcgtgcgggcatc
acttgggtaaacacatatcattttacatttaacgaagcgccttggggcggatataagcag
agcggaattggtcgaggactgggcacgtttggattggaagaatttcaagaagtaaaacaa
attaatattaatttacaagtagagccaatcggctggtttaaaaattaa

DBGET integrated database retrieval system