KEGG   Bacillus megaterium DSM 319: BMD_0866Help
Entry
BMD_0866          CDS       T01219                                 

Definition
(GenBank) Amino acid permease
  KO
K14052  putrescine importer
Organism
bmd  Bacillus megaterium DSM 319
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmd02000]
    BMD_0866
Transporters [BR:bmd02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BMD_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease
Motif
Other DBs
NCBI-ProteinID: ADF37728
UniProt: D5DB77
Position
848148..849527
Genome map
AA seq 459 aa AA seqDB search
MKHETVTLKRSLKLWQIVLMGIGYMTPMVVFDTFGIASDMTNGHVPTSYIIALVGMLLTA
VSYKKMIQVFPNAGSAYTYTQKTINPHLGFLVGWSALMDYLFLPMVNALIFQIYLSSIFP
SVPSWIWVVSFVIIVTLLNLRSVNFTANFNTFLVIFQMTILVLFVAVSIKALLGGMGEGT
LFSMKPFFNQNMTSSGLIAGATLMCFSYLGFDAVAMLSEETPNPKKTIPQAIFLVALIGG
VMFTVTSYFIQAVFPTLEGFKHPDAAAPEIAMYVSGTLFQIVFLAGGIAGTLSSGMSSHA
SVSRLLYVMGRDRILPQSFFGYVHPKLRTPSRNIVLVGVVSATAIFFSLATATSFINFGA
LIAFSFVNISVIAHYAVHQKQHRSAKGFWSYIIMPLLGAAAIGVLWLNLERNSFLLGIGW
AIAGLVYLAYATKGFRRQLSSIEFKETEEMSPLMKVGEK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgaaacagtaacattaaaaaggtcgttgaaattatggcagattgtattaatg
gggatcggatatatgactccgatggtagtgtttgatacgtttgggattgcgtctgatatg
acgaatggacacgttcctacgtcttatataatagcccttgtcgggatgcttctcacggca
gtaagctacaaaaagatgattcaagtgtttccaaatgcagggtcagcttatacatatacg
caaaagacaatcaatccgcatttagggttcttagttggctggtctgcactaatggattat
ctctttttaccgatggttaacgcacttatttttcaaatttatttatcatctatttttcct
tcggtaccatcgtggatttgggttgtcagcttcgtcattatcgttacgctgctaaattta
cgaagcgttaatttcaccgccaatttcaatacgtttcttgttatatttcaaatgacgatt
ttagtattgtttgttgctgtttcaatcaaagccttgctaggaggaatgggagaaggtact
cttttttctatgaagcctttctttaatcagaacatgacgtcatcagggctaatagcggga
gccacacttatgtgtttttcctatttaggatttgatgcagtggctatgttatcagaagaa
acgcccaatcctaaaaaaacgattccgcaagctatttttttagttgcgttaatcggagga
gtcatgtttaccgtgacatcttattttattcaagcggtttttccaacgttagaaggattt
aagcatccagacgctgcggctcctgaaattgctatgtatgtgagcggtacgctgtttcaa
attgtctttttagctggaggaattgcaggaacattatcatcaggcatgtcatcgcatgca
agcgtttcgcgtttattatacgtaatgggacgcgatcgaattttacctcagtcatttttt
ggttatgttcatcctaagctgcgcaccccttcgcgaaatattgtattagtcggagttgta
tcagcaactgccattttcttcagtctggcaacggctacgtcatttattaattttggagca
ctcattgcgttttcttttgttaatatttcggttattgcgcactatgctgttcatcaaaag
cagcaccggtcggctaagggtttttggtcatacattattatgccactattaggagcagcg
gcgattggcgttttatggcttaacttggagcgcaattcatttttacttggtattggctgg
gcgattgctggtttagtttatttagcgtatgcaacgaaaggttttagaaggcagctgtct
tccattgagtttaaggaaacagaagaaatgtcacctttgatgaaagtcggagaaaagtaa

DBGET integrated database retrieval system