KEGG   Bacillus megaterium DSM 319: BMD_0868Help
Entry
BMD_0868          CDS       T01219                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: ADF37730
UniProt: D5DB79
Position
850608..851993
Genome map
AA seq 461 aa AA seqDB search
MGKHIYLNAFDMNCVVHQTPGLWTYPSDQAVEYKTLDYWVKLAKLLEKGKFDGLFLADVL
GVYDVYRKSNEGALKQAAQLPVNEPTALISAMAYATKHLGFGVTVSTTYEKPYAFARKFS
TLDHLTNGRIAWNIVTSYLESGSINLGLEEHFTHETRYDIADEFLEVCYKLWEGSWEEGA
VVKDKEKGIFTLPDRVHPINHKGKWFSVPGVHLSEPSPQRTPVLFQAGASSPGRAFAAKH
AECIFTSFPTKKVAADYVKKMRAQIAAEGRDPKSVLIFNLFTPIVGRTEKEAEEKLAQFE
SYVNFEGAATLFSGWTGIDVSAYEPEQPIEFIATNSVRSALEKFTISDPDRKWTVEEVVK
FVSIGGMGPVTVGSPEQIADFMEGWIDDTGMDGFNMAYVTTPGTFGDFIDLVIPVLQERD
LFKTDYSEGTYREKLFKNSHFLPDEHYGAQYRKASQKESLT
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggggaaacatatttatttaaatgcgtttgatatgaattgtgttgtacatcagacacct
ggtttgtggacgtacccaagtgatcaggcggtcgaatataaaacgttagattactgggtg
aagttagctaagctattggaaaaaggaaagtttgacggtttgtttttagccgatgtatta
ggtgtttatgacgtttataggaaaagtaacgaaggagctcttaagcaagctgctcagctt
ccagtgaatgaaccaactgcgcttatttccgctatggcctatgccacaaagcatttaggg
tttggggtaacggtgtctactacttatgagaagccttatgcgtttgcgcgaaaattttcg
acgttggatcatttaacaaatggacgtattgcatggaatattgtgacttcatatcttgaa
agcgggtcaattaatctaggattagaagaacattttacgcatgaaacccgctatgatatt
gctgatgaatttttagaagtttgctataaattatgggaaggaagttgggaggaaggagct
gttgtaaaagataaagaaaaagggatctttacgcttccagaccgggttcatccgattaat
cataaagggaagtggtttagtgttccgggtgtacatttatcagaaccttccccgcagcga
actccagttttatttcaagcaggggcttctagcccaggaagagcatttgccgccaaacat
gctgagtgtatctttacaagttttcctactaaaaaagtagccgcagattatgtgaaaaaa
atgcgcgctcaaatcgctgcagaaggcagagacccaaagagcgtattaatttttaattta
tttacaccaattgttggacgaactgaaaaagaggctgaggagaagcttgctcagtttgag
agctatgtcaatttcgaaggagcagctacgctgtttagcggctggacgggaatcgatgtt
tctgcctatgaaccagaacagcctattgaatttattgcgacgaattcagttcgctccgct
ttagagaaatttacaataagtgatcccgatagaaagtggacggtagaagaggtagtgaaa
tttgtcagtatcggaggaatgggacctgttactgtggggagtccggaacaaatagctgat
tttatggaagggtggatagacgatacaggcatggatggatttaatatggcttatgtgact
acgccgggaacgtttggtgattttattgatttagtgattcctgttttgcaggaaagagat
ttattcaaaacagattacagtgaaggaacttatagagaaaaactatttaaaaactcacat
ttcttgcctgatgaacactatggcgctcagtatcgaaaggcgagccaaaaggagagctta
acatga

DBGET integrated database retrieval system