KEGG   Bacillus megaterium DSM 319: BMD_0871Help
Entry
BMD_0871          CDS       T01219                                 

Definition
(GenBank) acyl-CoA dehydrogenase
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-ProteinID: ADF37733
UniProt: D5DCB3
Position
854429..855619
Genome map
AA seq 396 aa AA seqDB search
MNNNQTIAASQEKILELANQLAKEFSKTAAKRDREGGTPLHERNLLRKSGLLALPIPKEY
GGYGAGWPIVFKVVNIIAKADSSLAHLLGYHYLTVCSTFLFGSTEQYKTFYKETAAQQLF
WGNAFNPRDSGLKAVRENGRLMLSGSKSFCSGATDSDRLLVSAQEEGSGEVLLCVLPTHR
AGIVIEDNWDGFGQRQTDSGSVKFEDVIVYEEEILRKAAEEQKVFPTVRTHLAQLMLTHL
LYGIAQGALEESKVYVKGHTKPWIGSDVEAAEQDPYIIQQYGEMSLNLHACSALIEKAVA
EFDHAWKKEDALTKQQRGESGIAIALAKTFTVKTVLHITSTIFDGMGARATSDQYKFDRY
WRNARTISLHDPIAYKLRDIGKWCLSSELPPITPYS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaccaaacgattgcagcgtctcaagagaagatccttgaattggctaaccag
ttggctaaagagttttccaaaaccgctgcaaaaagagatagagaaggtggaacgcctcta
catgagcgtaatttgcttagaaaaagcggtcttttagctctcccgattcctaaagaatac
gggggttatggagccggctggccgattgtttttaaagtcgtgaatatcattgcgaaagca
gatagttcacttgcgcacttgttggggtatcattatttgacggtttgttcgacgtttctg
tttggaagtactgagcagtacaaaactttttacaaagaaacagcagctcagcagctattt
tggggcaatgcctttaaccctagagattcaggactaaaagccgttcgagaaaatggaaga
ttaatgctcagcggaagcaagagtttttgttctggggcaaccgattcagaccgtttgtta
gtatcggctcaagaagaaggaagcggtgaggtattgctatgtgtacttcctactcataga
gccggaatcgttattgaagataattgggatggatttggccagcgccaaacggatagcgga
agtgtaaagtttgaagatgttatcgtttatgaagaagaaatattgcgtaaagcagctgaa
gagcaaaaggtttttcctacggtacgaacgcatttggctcagcttatgctcactcactta
ttgtacggtattgctcaaggcgctttggaagaatcaaaagtttacgtgaagggtcataca
aagccgtggataggttcagacgttgaagcagcagagcaagatccgtacattattcagcaa
tacggtgaaatgagtttaaaccttcatgcttgttcagcacttatagaaaaagctgttgca
gaatttgatcatgcatggaaaaaagaagatgcgctaacgaaacagcagcggggcgagtcc
ggaattgcgattgcgttggccaaaacatttactgtcaaaacggtcttacatattacctct
actatatttgatgggatgggagcgagagccacgtctgatcagtataaatttgatcgatac
tggcgcaacgcccggacaattagcttacacgatcctattgcttataagctgcgtgacata
gggaaatggtgtcttagcagtgaactgccgcctattacaccatattcatag

DBGET integrated database retrieval system