KEGG   Bacillus megaterium DSM 319: BMD_0872Help
Entry
BMD_0872          CDS       T01219                                 

Gene name
yfmC
Definition
(GenBank) iron(III)-citrate import ABC transporter, iron(III)-citrate-binding protein
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd02010  ABC transporters
Module
bmd_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BMD_0872 (yfmC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmd02000]
    BMD_0872 (yfmC)
Transporters [BR:bmd02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BMD_0872 (yfmC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: ADF37734
UniProt: D5DCB4
Position
855964..856908
Genome map
AA seq 314 aa AA seqDB search
MNKKKIGLLAFITMLAIGMLIGCSSTNKENSADEKSEKTRVVKHELGETKVKENPKRVVV
LELGFIDALLDAGIKPVGVADDDKAEQLIDKDVLKEIKGYKSVGTRAQPSLESIKLLKPD
LIIADSERHKNVYKELSKIAPTIELKNLNANYDDLLNTELKVGEAVGKKAKVEKVVEEHK
QKMKDLKAKAPKNPGNVLVIADANGNISARTSNFFTTGVLEQLGFKNALTDPTKEYSVKM
TMEQLVKADPDKLIVMRNEKGHTPLAKQPLWKELKAVKNNQVYEVDVFKWSLRRSVQGAN
GIADEAEKLLFEGK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttgaataagaaaaaaataggactgctggcttttattacaatgctggcaatcggaatgctt
atcggctgcagcagcacgaataaggaaaattcagctgatgaaaaaagtgaaaaaacaaga
gtggtcaagcatgagcttggagagacaaaggtaaaagagaatccaaagcgagtagtcgta
ttagagttaggctttattgatgcattgttagatgctggtatcaaacctgtaggagtagct
gatgatgataaagcagaacagcttattgataaagatgtactaaaagaaatcaaaggatac
aaatcagttggcacgcgagcgcagccaagtttggaatcgattaaactgctgaagcccgat
ttgattatcgccgattcagaacgtcataaaaatgtatacaaagaattatcgaaaattgcg
ccaacgattgagttaaaaaacttaaatgctaattacgatgatttactaaatacagagtta
aaagtaggagaagcggttggcaagaaagcaaaagttgaaaaagtggtagaagagcataag
caaaaaatgaaggatttaaaagcaaaagcaccaaaaaatccgggcaatgtacttgttatc
gctgatgcaaatggtaatattagtgctagaacttcaaatttctttacaacgggtgttctt
gagcaattaggcttcaaaaatgcattaacagatcctacaaaagagtacagtgtaaaaatg
acaatggaacagcttgtaaaagcagatccggacaaactcattgttatgcgaaatgaaaaa
ggtcatacgcctttagcaaaacagccattatggaaagagctaaaagcggttaaaaataat
caagtgtatgaagttgatgtatttaaatggtctcttcgccgaagtgtacaaggtgcaaat
ggtattgcagatgaagcagaaaagttattatttgaaggcaaataa

DBGET integrated database retrieval system