KEGG   Bacillus megaterium DSM 319: BMD_0873Help
Entry
BMD_0873          CDS       T01219                                 

Gene name
yfmD
Definition
(GenBank) iron(III)-citrate import ABC transporter, permease protein
  KO
K02015  iron complex transport system permease protein
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd02010  ABC transporters
Module
bmd_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BMD_0873 (yfmD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmd02000]
    BMD_0873 (yfmD)
Transporters [BR:bmd02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BMD_0873 (yfmD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: ADF37735
UniProt: D5DCB5
Position
856988..858022
Genome map
AA seq 344 aa AA seqDB search
MKAVHGLSKRNKSPLRIMAIFLAVFILLLISMFLSISIGSIHISFGTIKQAILNFDGSKE
QSIIQTVRLPRLLVTAFVGANLAVAGALMQALTRNPLASPGIFGINAGASAAMVFLTVLV
PSVSMIGGVFGAFLGGAFAAVIVYVMSSLIKGGDSDVKLALTGVAIQGMLTSLTQTLLIF
NESKTEGVMFWLTGSVIGRDWGHVHVLVPFSIAGLLIAFGLGRASSLLSLGDDVARGLGQ
RVFAIRAFTAVVVIVLAGVSVAIAGPIGFVGLVVPHMVRYLIGVDYRVVLPMSALLGASL
LLLADVLSRFITYPYETPVGAVTALLGTPYFIYLARRKKTERKA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttcacggcttatccaaaagaaacaaatctccgcttcgtataatggctatt
tttcttgcggtttttattcttttactgatttcaatgtttttatctatttccatcggttct
atacatatttcttttggaacgattaagcaagctatactaaattttgacggatcaaaagaa
cagtctattattcaaactgtccgtctgcctcgcttactggtaacggcatttgttggcgct
aatttggctgtcgctggagcgttgatgcaagcattaactagaaatccattagcttctcct
ggtatttttggtattaatgccggcgcatcagcggcaatggtatttttaacggttttagtg
cctagtgtaagcatgattggcggggtatttggtgcatttttagggggcgcatttgctgct
gttattgtttatgtcatgagttcgttgattaaaggaggcgacagtgatgtaaagcttgct
ttaacaggtgttgctatacaaggtatgcttacgtctctcacgcaaacgctgctgattttt
aatgaaagcaaaacagaaggcgttatgttctggctcaccggttcagttattgggcgagat
tggggacatgttcatgtattggttccttttagcatcgcgggcctgcttattgcgtttggt
ctgggaagagcgtcttctttattgtctttaggagatgacgtagctagaggactcgggcag
cgagtctttgccattagagcgttcactgcagttgttgtgattgtattagcaggtgtttcg
gtggcaattgcgggtcccattggctttgtagggcttgttgttcctcatatggtacgctat
ttaataggtgtagattaccgggtcgttttgccaatgagcgcgctgcttggtgcatcttta
ttgctgttagcagacgtattatcacgatttattacatacccgtatgagactcctgtaggt
gcagtaacagcattgctcggaacgccgtactttatttacttagcgagacgcaaaaaaaca
gaaaggaaggcatga

DBGET integrated database retrieval system