KEGG   Bacillus megaterium DSM 319: BMD_0878Help
Entry
BMD_0878          CDS       T01219                                 

Definition
(GenBank) MaoC like domain protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MaoC_dehydrat_N MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: ADF37740
UniProt: D5DCC0
Position
860892..861269
Genome map
AA seq 125 aa AA seqDB search
MECKTGDTFTWQRTFQEEEIMQFAEMTGDRGKHHIERDEKGRLMVHGLMTASIGTKIGGD
LNYIAREMVSEFLRPVFAGDTVTCECILTEVEKADGFKKVKIKSVYRNQQGKEVLIGTSN
GVIRD
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtaaaacaggagatacatttacgtggcaaagaacgtttcaagaggaagaaatc
atgcagtttgcagagatgactggagaccggggcaaacatcatatagaacgtgacgaaaaa
ggtcggctaatggtgcatggacttatgactgctagtattgggacaaaaataggaggagac
ttaaactacattgcaagagaaatggtgagtgaatttcttcgtccagtttttgcaggagat
acagttacctgtgaatgcatattaactgaagtagaaaaagcagatggttttaaaaaagtg
aaaatcaaatcagtgtatcgaaatcaacaaggtaaagaagtactgatagggacaagtaat
ggagttattagagattaa

DBGET integrated database retrieval system