KEGG   Bacillus megaterium DSM 319: BMD_0881Help
Entry
BMD_0881          CDS       T01219                                 

Definition
(GenBank) helix-turn-helix domain, rpiR family protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS HTH_6 SIS_2
Motif
Other DBs
NCBI-ProteinID: ADF37743
UniProt: D5DCC3
Position
863926..864780
Genome map
AA seq 284 aa AA seqDB search
MSTGGLTMIKNTVAKLPDSERKIAEYILNNPHTVVNSTAGELGRLANASSAAVIRLCKSI
GVSGFQELKVRVAGDLARDTEQGYRDIETNETIQSIVKKTASNSIQSLSDTAELVNYKEA
ERAVLALIEAKNIHFFGIGASHIIAMDAQQKFLRINKNATAFADSHLAATLIANASKDDV
VVGISFSGETPEVSNVLSLAKNRGVKTISLTKYGQSTVSSLADICLYTSYSQEAPFRSAA
TSSRLAQLYVIDVLFLSIAAQQYDQTIEYIDKTRDAIQFLKTKK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaggcggattaacaatgattaaaaacacggtggctaagcttccagattcggag
aggaaaattgctgaatatattttaaacaacccgcatactgtggtaaacagtacggctggg
gaactaggtagactagcgaatgcgagcagtgctgctgttattcgtttgtgtaaatctatc
ggggttagcgggtttcaagaattaaaggtaagagtagccggtgatttagctagagataca
gagcaaggataccgcgatattgaaacaaatgaaacgattcaatctattgtcaaaaaaacg
gcaagcaacagcattcaaagtctaagtgatacggccgagcttgtgaattataaagaagca
gagcgggctgttttggcgctgattgaagccaaaaacattcatttttttggaatcggtgct
tcacatattattgctatggatgcacagcaaaaatttcttcgaattaataaaaatgcgacg
gcttttgcagatagccatttagcagctacactcatcgcaaatgcaagtaaagacgatgta
gttgtgggcatctctttttcaggggagactcctgaagtaagcaacgtcttatccttagct
aaaaatcgcggagtgaagacaattagcttaaccaagtacggacagtcaaccgtttcgtct
ttagctgatatttgtttgtatacgtcttattctcaagaagcgccgtttcgaagcgcagct
acatcgtctcgtttagcccagctgtatgtgattgatgtgttatttttaagtattgcagcg
cagcagtatgaccagacgattgagtatattgataaaactagggatgccattcagtttttg
aaaactaaaaaataa

DBGET integrated database retrieval system