KEGG   Bacillus megaterium DSM 319: BMD_0883Help
Entry
BMD_0883          CDS       T01219                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09963  uncharacterized protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF871
Motif
Other DBs
NCBI-ProteinID: ADF37745
UniProt: D5DCC5
Position
866227..867237
Genome map
AA seq 336 aa AA seqDB search
MIGISFYLNDSDAPKKLIEASECGVTRAFTSLHIPEEKGDLAERAKELLHVARDCGISVY
ADVSKHTPVHLGIESLMSLSSLGVSGIRLDDGFSAEETLSLANEFYIAVNASTLSKQEIE
ALLSAGLHHHQLLAWHNFYPRPETGLEETFFQQQTDLFNELRIPVCAYIPGEDEKRGPIY
QGLPTREKDRNRCPFTSAVDLYGCGVAEVYIGDPCAGSSLLKRLVQYQESRIIPLRIRSP
HIEGTYSVRPDVSRDVLRLVDTRSVKPVPPFHTVERRMGAITMDNDGYGRYRGEIQIAKT
NLPANANVNVIGYVIEEDHELLSLVRPGQKLVLLPV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtatttcgttttatttaaatgatagtgatgccccaaaaaaattaatagaagcg
agtgagtgcggcgtcacacgtgcattcacttcgcttcacattccagaagaaaaaggagat
ttggctgaacgggcaaaagaattgcttcatgtggctagagattgtggaataagcgtgtat
gcagacgtatctaagcatacgccagttcatttaggtattgaaagccttatgtcgctatct
tcacttggcgtatctggtattagactagacgatggctttagcgcagaagaaactctttcg
cttgcgaatgaattttatattgctgttaatgcaagtacgttatccaaacaagaaattgaa
gcactcttatctgcaggtcttcatcatcatcagctgcttgcatggcataatttttatccg
cggcctgaaacagggcttgaagaaacgttttttcaacagcagacagatttatttaatgaa
cttcgtattccagtctgcgcttatattcctggagaagacgaaaaaagaggccctatttat
caaggtcttcctactagagaaaaagaccgtaatagatgtccttttacttctgcagtagat
ttatatggatgcggagtagcagaggtttatattggagatccatgcgccggttcaagttta
ttaaagcgtttggttcaatatcaagaaagccgcattattccgctgcgcattcgttcacct
catatagagggaacgtacagcgtgcgtccggatgtatcaagagacgttctgcgtttagtt
gatactcgatctgtaaaaccagtgccgccatttcatacagtagaacgcagaatgggagca
attacgatggacaatgatggctacggacgttacagaggagagattcaaatagctaaaacg
aatttgcctgcaaatgctaatgtgaatgtgattgggtatgtgatagaagaagatcatgag
ctgctttcgttagtgagaccggggcaaaaacttgtgcttcttcctgtctga

DBGET integrated database retrieval system