KEGG   Bacillus megaterium DSM 319: BMD_0885Help
Entry
BMD_0885          CDS       T01219                                 

Definition
(GenBank) tena/thi-4 family domain protein
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00730  Thiamine metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BMD_0885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmd03000]
    BMD_0885
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BMD_0885
Transcription factors [BR:bmd03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BMD_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 DUF2309
Motif
Other DBs
NCBI-ProteinID: ADF37747
UniProt: D5DCC7
Position
868956..869627
Genome map
AA seq 223 aa AA seqDB search
MKFSERLYEKLQPIWRQNHNHPFVQGMGDGTLEKEKFRFYMIQDYLYLIDYAKLFAIGAM
KATDLQTMGKFAALLDSTLNEEMSLHREYAKKFEISEKELEKAQPSPTTLAYTHYMLHVG
QSGTLAELVAALLPCMWSYWEIGKELSEKPGANNEFYREWIEMYSSEEFGELATWCINLF
DSLTEDKSEAELEKLEEIFLNTTRFEYMFWDMAYNEAMWPIHE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtgagcgattatacgaaaagctgcagcctatttggcgtcaaaatcataat
catccctttgtacagggaatgggagacggaacgcttgaaaaggagaagtttcgcttttac
atgattcaagattacctttacctaattgattatgccaaattatttgcgattggagccatg
aaagctaccgatcttcaaacgatggggaaatttgctgcacttttggattctacattaaac
gaagaaatgagcctgcaccgtgagtatgccaagaaatttgaaatcagcgaaaaagaatta
gaaaaagcgcagccatctcctacaacgcttgcatacacacactatatgctgcacgttggt
caaagcggaacattagctgaattagtggcggctcttttgccttgtatgtggagctactgg
gaaataggaaaagaactcagtgaaaagcctggagctaacaatgaattttatcgtgagtgg
attgaaatgtacagctcagaagaatttggagaactagctacatggtgtattaatttattc
gactcacttactgaagacaaatcagaagcggaattagaaaagctcgaagaaattttctta
aatacaacgcgttttgaatatatgttctgggatatggcttataacgaagcgatgtggcca
attcatgaataa

DBGET integrated database retrieval system