KEGG   Bacillus megaterium DSM 319: BMD_0887Help
Entry
BMD_0887          CDS       T01219                                 

Definition
(GenBank) ABC transporter, permease protein
  KO
K15599  putative hydroxymethylpyrimidine transport system permease protein
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd02010  ABC transporters
Module
bmd_M00442  Putative hydroxymethylpyrimidine transport system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BMD_0887
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmd02000]
    BMD_0887
Transporters [BR:bmd02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative hydroxymethylpyrimidine transporter [MD:M00442]
    BMD_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADF37749
UniProt: D5DCC9
Position
870381..871124
Genome map
AA seq 247 aa AA seqDB search
MKKYGASVILVVILLAAWEIGARIVNYPFILPTPTGILTKLWDLRMDLLFKHLPATLSIV
VIGLVISVVLGVLLAVWMNWSPLIERAFYPLIIASQMIPTIAIAPVFVLWFGYSIWSKVI
VTVLITFFPITVSTFDGLRSTNKELKELMLTMGATKKDIFFKLNIPSALPHFYSGLKVAV
TFSIIGAAIGEWLGAQAGLGYFSRRMMTQFDAAGVFAPIVILSALGILFFIIVAGFEKRS
LKWRKTE
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtacggagcttcagtgatattagtagtcattttactggctgcttgggaaatt
ggagcacgcattgtaaactatccgtttattttaccaacgcccaccggtattttaacgaag
ctttgggatttgcgaatggatttattgtttaagcatttaccagctacgttatctattgtc
gtaattgggctggttatatccgttgtgctaggggttctgctggccgtgtggatgaattgg
agcccgcttattgagcgtgctttctatccgcttattattgcgtcacaaatgatcccgacc
attgccattgctcctgtatttgttctctggtttggctactccatttggagcaaagtgatt
gtgaccgtattaattacgttttttcccattaccgttagcacgtttgacgggcttcgttcc
acaaacaaagagttaaaagaactcatgttaacgatgggagcaacaaaaaaagatattttc
tttaagttgaacattccttctgcactgcctcatttttattcagggctcaaagtagcggtt
acctttagtataataggtgctgccattggcgaatggttaggtgcacaagcaggcttagga
tatttcagtcgtcgcatgatgacacagtttgatgcagctggtgtatttgcaccaattgta
attttatctgcgcttggtattttattctttattattgtagcaggttttgaaaaacgttca
ttaaagtggaggaaaacagaatga

DBGET integrated database retrieval system