KEGG   Bacillus megaterium DSM 319: BMD_0901Help
Entry
BMD_0901          CDS       T01219                                 

Gene name
rpoN
Definition
(GenBank) RNA polymerase sigma-54 factor
  KO
K03092  RNA polymerase sigma-54 factor
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMD_0901 (rpoN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bmd03021]
    BMD_0901 (rpoN)
Transcription machinery [BR:bmd03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BMD_0901 (rpoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_DBD Sigma54_CBD Sigma54_AID HTH_23 RepL HTH_38 HTH_3 DUF1128 HTH_Tnp_Tc3_2
Motif
Other DBs
NCBI-ProteinID: ADF37763
UniProt: D5DCE3
Position
complement(882539..883873)
Genome map
AA seq 444 aa AA seqDB search
MQLGLDLSQKQLLKLAMTPELRQSINILNYSTADLVHYLHQQVNENPVIKLSAGDSQQKD
SFDTREQRSYSKGYTDDEYNPFNYISDQTVTLESHLLEQLSMLNHLHTHQKHIVQFLIGN
LNKNGFLAIEPKLAAELLNVSINEVNDMIHVLQSFDPLGVGAQNFVDSLLIQIKAKKSKP
PLLYDVVKHDIEDIANKKYRNISKKYSISMREVQEIVDCLRTLNPRPAGDFHVPLTKYIS
PDVTVQKVDGRYHVILHSELLPPIEINGTYQKLVHRSACVTTDRYVQEKIHEATWLINSI
EQRNATIYNVSKAIVEHQQDFFEMGISGLKPLTLKDIAQKIDCHESTVSRATNGKYIQTP
RGLFELKYFFTNSLERTDGEQSNSTAFIKEKIKTLIAEENKLKPLSDQKLMSLLSSEGIQ
ISRRTVAKYREEAGIESSSKRRRF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaggtttagatttatcccaaaaacaactattaaaattggccatgacacctgaa
ttacgtcagtctatcaacattttaaattattctacggccgatttagttcattatcttcat
cagcaagtcaatgaaaatcctgtaattaaactgtctgctggcgactctcagcaaaaagat
tcatttgatactcgagaacagcgttcatattcaaaaggttataccgatgacgagtataat
ccgtttaattatatatctgatcaaactgtgacattagagagtcatttattagagcagctg
tctatgctaaatcatttacacacacaccaaaaacacatcgttcaatttctaattggaaac
ttaaataaaaacggctttttagcaattgagccaaaattggcagccgaactgctgaatgtg
tcaattaacgaagtcaacgatatgattcacgttttacaaagctttgatccgcttggcgtg
ggcgctcaaaattttgtcgattcactgcttattcaaattaaggccaaaaagtcaaagcct
cctcttttatacgacgtggtaaaacacgatattgaagatattgccaacaaaaaatatcgg
aacatttcaaaaaaatactctatttcgatgcgtgaagtacaagaaattgttgactgcttg
cggacattaaatcctcgtccagcaggagatttccatgtcccgcttacgaagtacatctcg
cctgatgtaacggtacaaaaagttgacggccgctatcatgttattcttcatagcgagctg
cttccgcccatcgaaattaacggcacctaccaaaagctggttcatcgctctgcatgcgta
acaaccgatcgatacgtacaggaaaaaattcatgaagctacttggctaatcaatagtatt
gagcagcgtaatgcgacgatttacaacgtgtccaaagccattgtggaacatcagcaagat
ttttttgaaatgggtatttcggggctaaagccgcttaccttaaaagatattgctcaaaaa
atagactgtcacgaatcaacggtaagtcgtgcgactaacggaaagtatattcaaacgcca
cgcgggctgtttgagttaaaatactttttcaccaattctttagagcgaactgatggcgaa
caaagcaattctactgcctttataaaagaaaaaatcaaaacattaattgccgaagaaaat
aaattaaaacctctttcagatcaaaagctcatgtctcttctttccagcgaaggaattcag
atttcaagaagaacagtagctaaataccgtgaagaagcaggaattgaaagttcttctaag
cggcgacgattttaa

DBGET integrated database retrieval system