KEGG   Bacillus megaterium DSM 319: BMD_0902Help
Entry
BMD_0902          CDS       T01219                                 

Definition
(GenBank) transcriptional regulator, MarR family putative
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR HTH_5 HTH_34 MarR PadR HTH_20
Motif
Other DBs
NCBI-ProteinID: ADF37764
UniProt: D5DCE4
Position
complement(884089..884418)
Genome map
AA seq 109 aa AA seqDB search
MKAPHYNVPVEATLEVIGGKWKVVILCLLKEGEKRFSELQRAMPAITKKMLSQQLKELEK
DGVVNRKVYNEVPPKVEYSLSEEGETLREILNMMCAWGDRRMGNTPNCS
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcaccccactataatgtacctgttgaagcaacgcttgaagtaattggcgggaaa
tggaaagtcgttattttatgcctattaaaagaaggtgaaaaacgttttagtgaacttcag
cgagctatgcctgctattaccaaaaaaatgctgtctcaacagctaaaagaattagaaaaa
gacggtgtggtcaatagaaaagtatacaatgaagttcctcctaaagtagagtactcactg
agtgaagaaggcgaaaccttacgagaaattttaaatatgatgtgcgcatggggagataga
agaatgggaaacaccccaaattgcagctaa

DBGET integrated database retrieval system