KEGG   Bacillus megaterium DSM 319: BMD_0905Help
Entry
BMD_0905          CDS       T01219                                 

Gene name
yfiC
Definition
(GenBank) putative ABC transporter, ATP-binding/permease protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
bmd  Bacillus megaterium DSM 319
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmd02000]
    BMD_0905 (yfiC)
Transporters [BR:bmd02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BMD_0905 (yfiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_15 AAA_21 AAA_22 AAA_30 AAA_16 DEAD AAA_23 CitMHS AAA RsgA_GTPase MMR_HSR1 AAA_29 AAA_24 T2SSE AAA_18 TsaE ABC_membrane_2 Zeta_toxin AAA_19 SART-1 NfeD
Motif
Other DBs
NCBI-ProteinID: ADF37766
UniProt: D5DCE6
Position
complement(885919..887703)
Genome map
AA seq 594 aa AA seqDB search
MSSIRGPRGMMKGPVVKPKNAKKTLYRIWSYMGKRKPPLAATIILVIVTSLLNLLGPYLI
GVIIDEHIIPKDISGTIRMSLILAGIYITTSLLTWLQTYLMVNVSFTTIGMLRQDLFAKL
QTLSLRFFDKRAHGELMSRVTNDIDNLNSALSQSVIQALSSILSLFGITIAMFSLNWILA
IITLIVIPLMVIIVRQILKRSSENFVKRQKDLGELNGFVEEAISGGEVVTLFSKEKDFLT
VFNERNEQLRSSATKAETFSGFLGPVTNFINNLGLALVIGAGAFMAVQGSVTVGMIASFV
NYSRQFSRPISQMANLVNTILSAIAGAERVFAIMDEQPDVTNKPNALSVTKFAGDVAFEN
VSFGYNDEKMILKNVTLTAKKGEMVALVGPTGSGKTTIINLLTRFYDISNGDIKIDGRSI
SDYNIHDLRKRIGIVLQDTYLFSGTIADNIRFGRLDASDEEVKSAAKMANAHSFIKHLPQ
QYNTVISAGGGNLSEGQKQLLSIARAMLSDCDILILDEATSNIDTKTEIDIQRGMSNLLK
GKTSFVIAHRLKTIENADQILVLKDGQIIEEGNHRELLEKQGFYHKLYTQQFTI
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgagctctattcgcggccctagaggaatgatgaaaggccctgtagttaagccaaaaaat
gcgaaaaaaacactgtacagaatctggtcatatatggggaaacgaaaacctccgcttgcg
gctacgataatcttagttattgtgacttccctgcttaatttattaggcccttatttaatt
ggggttattattgatgagcatattattcccaaagatatcagcggaacgatacgaatgtcc
cttattcttgcaggaatttatattacgacatctttgttaacatggctgcaaacctattta
atggtgaacgtttcgtttacgactattggaatgcttcgacaagatttatttgcaaagctt
cagactctctcccttcgcttttttgacaaacgagctcacggagagttaatgagcagagtc
acaaatgatattgataatctaaacagcgctctgagtcaaagcgttattcaggctctgtcc
tctattttgtctttattcggcattaccattgcgatgttctcgctcaactggattcttgcc
attatcacgctgattgttattcccttgatggttataatcgttcgacaaatattaaaacgt
agcagtgaaaattttgtcaaacgccaaaaagacttaggcgagctaaacggctttgtagaa
gaagcaatctctggaggagaagttgttacgctttttagtaaggaaaaagactttttaact
gtttttaatgaacgaaatgaacagctgagaagttcagcaacaaaagcggaaacattttca
ggctttttaggtcctgtcacaaactttattaacaacttaggcttagcactagtgatcgga
gcgggagcatttatggctgttcaaggtagcgttacagttgggatgattgcttcatttgtt
aactactcacgtcagttctctcgcccaatcagtcaaatggcaaacttagtaaacaccatt
ctttcggctattgccggcgcagagcgcgtgtttgcgattatggatgagcagccggacgtc
acaaacaagccaaacgctctttctgttacaaaatttgcaggagacgttgcttttgagaac
gtatcatttggctataacgatgaaaaaatgattttaaaaaatgttacactgacagcaaaa
aaaggtgaaatggttgctttggtcggtccgacaggttctggtaaaacaaccatcattaac
ttgctcacacgattttatgacatctcaaacggagacattaaaattgacggacgttccatc
agtgactataacattcatgatttacgaaaacgaatcggcattgttcttcaagatacctat
ttattttccggtacgattgcggataacattcgatttggccggttagatgccagcgacgaa
gaagtgaaaagcgccgcaaagatggccaatgctcattcgtttatcaaacatttgcctcag
caatacaataccgtgatttcagctggcggaggaaatttaagtgaaggtcaaaagcagctt
ttatcgattgctcgagccatgctttctgactgtgatattttaattttagacgaagctact
tccaacattgatacaaaaacagaaattgatattcaacgaggaatgagtaatctattaaaa
ggaaaaacaagctttgtcattgcccaccgccttaaaacgattgaaaatgcagatcaaatc
cttgtcttaaaagacggacaaattattgaagaaggaaatcatcgcgagctgctagagaaa
caagggttttatcacaagctctatacgcagcagtttacgatttaa

DBGET integrated database retrieval system