KEGG   Bacillus megaterium DSM 319: BMD_0906Help
Entry
BMD_0906          CDS       T01219                                 

Gene name
malQ
Definition
(GenBank) maltose and maltodextrin ABC transporter, ATP-binding/permease protein MalQ
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
bmd  Bacillus megaterium DSM 319
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmd02000]
    BMD_0906 (malQ)
Transporters [BR:bmd02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BMD_0906 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N DUF87 AAA_22 RsgA_GTPase AAA_16 ABC_ATPase AAA_18 Tetraspannin AAA_5 Sigma54_activat IstB_IS21 AAA_29 AAA_21 ATP-synt_ab ArgK AAA_30
Motif
Other DBs
NCBI-ProteinID: ADF37767
UniProt: D5DCE7
Position
complement(887720..889462)
Genome map
AA seq 580 aa AA seqDB search
MNTIKSLYPYLKPYKWLALFAPLLMVIEVLADLLQPTIMQHIIDYGIANNDQTYVITRSI
LMLMLAVIGLAAGIVCAILSTKAAVNFSTDIRKSLFEKIENLSNSNRDKLGTGHLITVMT
NDVTSVQNALNMTLKVLVRGPLLFAGSIVIVLLTARSLFPIIVVVVPILFLCIWFVITKA
GKLFKKVQQSVDRVNTKVQENLSGMRVVKAYVRESYEINQFKEANSSLTRANMSAVQLIS
LLMPVILFVVNIGMVATLWLGGLQVEAGKIEAGVILAFINYLTIILNGLMSSSMVLMQIT
RAFPSAERIDSVLKTKIDIPPANSAAQINRLKGDLSFQNVTYSYSKNGENVLKDISFTAR
HGETIGIIGSTGSGKSTLAKLISRLYDPDDGEIFVDGKNLTDYDVKVLRSSIGFIPQKAT
LFTGTIDMNIRMGKDQASSSEIEDAANFACATEFIEKLPERYEYPLTRGATNLSGGQKQR
LSIARAFVRKPAILVIDDATSALDAVSEAQVLKHLKEEFADATVIIIASKISSLLHADHI
IVMDEGKIAEQGTHEELLRYRSLYYDIYLAQGGKEVLPSE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacaattaaatctttgtacccttacttaaaaccttacaaatggctcgcgctgttt
gccccgctgttgatggtaattgaagtgttagctgaccttcttcagcctactattatgcag
catatcattgattatggcattgcaaacaacgatcaaacatatgttatcactcgaagcatc
cttatgcttatgttagcagtcattggcttagctgccggtatcgtctgcgccatccttagc
acaaaagcggcagtaaatttttctaccgatattaggaaatcgctttttgaaaaaattgaa
aacctctcaaacagcaacagagacaaactagggactggtcacttaattaccgtcatgaca
aatgatgtaacgagtgttcaaaacgcattgaatatgacgctaaaagtattagttagaggt
cctttgctttttgcaggaagtattgtgatcgtgttattaaccgctcgttctttgtttcct
attatcgtcgtggtcgtccctattttatttttatgcatttggtttgtgatcacgaaagct
ggaaaactttttaaaaaagttcagcaaagcgttgatcgtgtaaatacaaaagtccaagaa
aatttatcagggatgcgtgtagtaaaagcgtatgtaagagaatcgtatgaaatcaatcag
tttaaagaagcaaacagttccttgacgcgagctaatatgagtgctgttcagcttatttcg
cttttaatgcccgttattttatttgtagtaaatatcggaatggtagctactctatggctg
ggaggacttcaagtcgaagcaggaaaaattgaagcaggtgtgattttagcttttattaat
tacttaacgattattttaaacggacttatgtcaagcagcatggtgctgatgcaaattaca
cgcgcattcccttcagctgaacgaatcgattctgttttaaaaacaaaaatagacatccct
ccagcaaactctgccgctcaaatcaacagacttaaaggtgatctatcgtttcaaaacgtt
acatacagctatagtaaaaatggcgaaaacgtattaaaagatatttcgttcactgctaga
cacggggaaaccattggcattatcggctctactggaagcgggaagtcgacgcttgcaaaa
cttatttcccgcttatatgatcctgatgacggcgaaatcttcgtagatggaaaaaatctt
acggactatgacgtaaaagtgcttcgctcatccattgggtttattcctcaaaaagctacg
ctgtttaccggcacgattgatatgaatattcgaatgggaaaagatcaggcttcttcctca
gaaattgaagatgctgcgaattttgcatgcgcaacggagtttattgaaaaacttccagaa
agatatgagtatcctttaacgcgaggagcaaccaatttatcaggagggcaaaagcaacgt
ctttcaatcgcgcgtgcatttgttagaaagcccgctatcctggtcatcgatgatgcaact
tcggcattagacgctgtctcagaagcgcaggtactaaaacatttaaaagaagagtttgct
gatgcgaccgttatcattattgcttctaaaatttcgtctcttctccacgctgatcatatt
atcgtcatggatgaaggcaaaattgctgaacaagggactcatgaagaattgcttcgttat
cgctctctttattacgacatttaccttgcacaaggcggaaaagaggtgttgcctagtgaa
taa

DBGET integrated database retrieval system