KEGG   Bacillus megaterium DSM 319: BMD_0909Help
Entry
BMD_0909          CDS       T01219                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF485
Motif
Other DBs
NCBI-ProteinID: ADF37770
UniProt: D5DCF0
Position
complement(891682..892023)
Genome map
AA seq 113 aa AA seqDB search
MAMNENSLKKVNNASSSPNYTEIAQSASFQKLLKQKRNFILPLSLFFLAFYFTLPILTAY
TTVLNKPAFASMTWAWVFAFAQFVMTWTLCILYTKRASKFDELVDTIKKEAAN
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
ttggcgatgaatgaaaattctttaaagaaggtaaacaatgcttcttcctctcctaattac
acagaaattgcacagtctgcttcatttcaaaagcttttgaaacaaaaacgcaattttatt
ttaccgctctctctgttttttcttgctttttattttaccttgcctattttaacggcttac
acaaccgtcttaaacaaaccagcttttgcttctatgacctgggcgtgggtatttgctttt
gcacagtttgtgatgacctggaccctatgcattttatacacaaaaagagcctcgaaattt
gatgaacttgttgacacgattaaaaaagaagctgcaaattaa

DBGET integrated database retrieval system