KEGG   Bacillus megaterium DSM 319: BMD_0918Help
Entry
BMD_0918          CDS       T01219                                 

Definition
(GenBank) NADPH-dependent FMN reductase
  KO
K03809  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00130  Ubiquinone and other terpenoid-quinone biosynthesis
bmd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BMD_0918
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     BMD_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_1 Flavodoxin_5 Flavodoxin_3
Motif
Other DBs
NCBI-ProteinID: ADF37779
UniProt: D5DCF9
Position
898757..899287
Genome map
AA seq 176 aa AA seqDB search
MKICIVYDSEGGHTEALAKAIASGAELSGEATVYVKHVEEADVRELPEMDAIIWGCPGHF
GTISSGLKTWIDKLGYLWAEGKLIDKVGAVFCTTATTHGGLEATLLNLITPMLHQGMIIA
GLPGNIPENALYGTYYGVGITCPIEGDELLTENDQALGKALGERVVQVTKRMTQGQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttgtatcgtatatgatagtgaaggcggacatacagaggcattagcaaaagcg
attgcttctggcgccgagctgtctggagaagcaactgtatatgtaaagcatgtagaagaa
gcagatgtacgtgaactgcctgaaatggatgctattatttggggctgcccagggcatttt
ggaacaatcagttcagggttaaaaacgtggattgataaattaggttatttatgggcagaa
ggtaaattaattgataaagtaggtgcggtgttctgtacaacagctacaacgcacggtggc
ttagaagcaacgcttttaaatttaattacaccgatgcttcatcaaggaatgattatcgct
ggcttaccaggtaacattccagaaaatgcgctgtacggtacttattacggtgtgggaatt
acttgtccaatcgaaggtgacgaattattaacagagaacgaccaagcgctaggtaaagcg
ttaggagaacgtgttgttcaagtgactaaacgaatgacacaaggacagtag

DBGET integrated database retrieval system