KEGG   Bacillus megaterium DSM 319: BMD_1874Help
Entry
BMD_1874          CDS       T01219                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00010  Glycolysis / Gluconeogenesis
bmd00020  Citrate cycle (TCA cycle)
bmd00620  Pyruvate metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01130  Biosynthesis of antibiotics
bmd01200  Carbon metabolism
Module
bmd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMD_1874 (acoC)
   00020 Citrate cycle (TCA cycle)
    BMD_1874 (acoC)
   00620 Pyruvate metabolism
    BMD_1874 (acoC)
Enzymes [BR:bmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMD_1874 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H DUF2118 AATase PYNP_C UPF0524
Motif
Other DBs
NCBI-ProteinID: ADF38727
UniProt: D5DF54
Position
1874842..1876068
Genome map
AA seq 408 aa AA seqDB search
MAAEVVMPKLGMAMKEGTVSTWNKKVGDSVSKGDMIASINSEKIEMEIEAPQDGVILDIL
VQEDVGVPPGTIICYVGKPNEQLTEQNSSANELQAPKNEVAATISLEEPPVNAASSKKSK
ETVLISPIARKIAESENLNVETIKGTGPKGRITKADVEKVLAERASEASRPPAEIDKAIK
KETLPVAGMRKVIASRMHNSLLNSAQLTINMKADVTDLLSLQREVKDVIQQRHKVKISLT
DFIARAVVLSLQEHKQMNSAYIDNEIHLYNHVHLGMAVALENGLVVPVVQHAEKMSLVEL
AAEIKTRAADARQGQLSTDRMQGSTFTITNLGAYGVEYFTPVLNPPETGILGVGATEDVP
MYKGDELQKRNLLPLSLTFDHRVLDGAPAANFLGTIKQYLEQPILLLL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagaggttgtaatgccaaaactaggtatggcaatgaaagaaggaaccgtttcg
acatggaataaaaaagttggagactccgtttcaaaaggagatatgattgcaagcattaat
tctgaaaaaatagaaatggaaattgaagctccgcaggacggtgtgattcttgatattctt
gtgcaagaagatgtaggggtgcctcctggaacgattatctgttatgttggaaagccaaac
gagcagcttactgagcaaaacagttcagcaaatgagctccaggctcccaaaaacgaagta
gctgccactatttctttagaagagccgccagtaaacgcagcttcatcaaagaagagcaaa
gaaacggtgcttatttcaccaattgcacggaaaatagcagaatctgaaaacctgaatgtt
gaaacgattaaaggcacaggaccaaaaggaagaatcaccaaagcagatgtagagaaagtg
ctggcggaaagagcttcagaagcgagtcgtccaccagcagaaatagataaagctataaaa
aaagaaacgcttccagtagcgggcatgagaaaagtcattgcaagtcgaatgcataatagt
ttattaaacagtgcccaattaacgattaatatgaaagctgacgtgacggatttgctgtct
ctgcaacgggaagtcaaagatgtgatccaacaacgccataaggtgaagatatctctaact
gattttattgctcgcgctgttgttctttcacttcaagaacataaacaaatgaacagtgct
tatatagataacgaaattcatctctataaccatgttcatcttggaatggccgtagcctta
gagaatgggttagtagtccctgttgtgcaacatgctgaaaagatgtcgttagttgaatta
gctgcagagatcaaaacacgagcagcagatgctcggcagggtcagctgagcactgataga
atgcaaggttctacattcactattactaatctcggtgcttacggagtagagtattttaca
cctgtattaaacccgcctgaaacaggaattcttggtgttggagctactgaagatgtaccg
atgtataaaggagacgaattacaaaaaagaaacttgctgcctttaagcctgacgtttgat
catcgcgtactggacggagcacctgcagctaatttccttggaactattaaacaatactta
gagcaacctattttactactcttatag

DBGET integrated database retrieval system