KEGG   Bacillus megaterium DSM 319: BMD_1877Help
Entry
BMD_1877          CDS       T01219                                 

Gene name
bdhA
Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BMD_1877 (bdhA)
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BMD_1877 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BMD_1877 (bdhA)
    1.1.1.-  
     BMD_1877 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADF38730
UniProt: D5DF57
Position
1879660..1880709
Genome map
AA seq 349 aa AA seqDB search
MKALRWHGVKDVRLEHIAEPTVSQGKVKIKVEWCGICGSDLHEYTAGPIFIPTEELHPLS
KDKAPVVLGHEFSGQVVEIGEGITNVKVGDRVVVEPIYACGECENCKQGKYNLCNKMGFY
GLAGGGGGFSEYASIPVEMIHKIPEVVSYEQGALVEPSAVALHAVRQSKLKVGDKAAVFG
TGPIGLLVIEALKASGASEIYAIELSEQRRQKAEELGAIAIDPQEYDPVAEVHKRTGGGV
DVSYEVTSVPLVLTQAINSTKSGGETMIVSIFEKEASIHPQTIVLQERTVTGIIGYRDVF
PAVISLMAKGYFSADKLVTKRIKLEQVIEEGFETLLKEKEQVKILVKAE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattaagatggcatggcgttaaagatgtaaggttagaacatattgcagaacct
actgtctctcaagggaaagtgaaaattaaagtagaatggtgtggaatttgcggaagtgat
ttgcatgagtacacggcaggacccatttttattcctacagaagaactccatccattaagc
aaagataaagcgccggttgtgctgggacatgaattttctggacaagttgtagaaatcgga
gaaggtattacgaatgtaaaagtcggagacagagtagtggtagaacctatctatgcatgc
ggagagtgtgaaaactgtaaacaaggaaagtataatctttgtaataaaatggggttttat
ggtcttgccggaggtggcggaggtttttctgagtatgcctccataccggtagaaatgatt
cataaaataccggaagtggtgtcttacgagcaaggagctctcgtagagccttcagctgtg
gctcttcatgctgtgcgtcaaagcaaactaaaggtaggagataaagccgccgtatttggg
acggggccaatcggtttactagttattgaagcgttaaaagcatctggtgcatctgaaatt
tatgcgatcgaactatcggaacagcgcagacagaaagctgaagaacttggggcgattgcc
attgacccgcaagaatacgaccccgtagcagaagtacataagcgcacaggcggaggtgta
gacgtttcctatgaagtgacaagtgttcccttagttttaactcaagccattaattctacc
aaaagtggcggggagacaatgattgttagtatattcgaaaaagaagcgtccattcatccc
caaacaatcgttttacaagagcgtacagtaacaggtattattggctaccgcgatgtattt
ccagcggttattagtttaatggcaaaaggctatttttctgctgataaactggtgacaaaa
cgtattaaactagaacaggtgattgaagaaggttttgagacattgttaaaagaaaaagaa
caagtgaaaattttggtgaaagccgaataa

DBGET integrated database retrieval system