KEGG   Bacillus megaterium DSM 319: BMD_1938Help
Entry
BMD_1938          CDS       T01219                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00670  One carbon pool by folate
bmd01100  Metabolic pathways
bmd01120  Microbial metabolism in diverse environments
bmd01200  Carbon metabolism
Module
bmd_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BMD_1938 (fhs)
Enzymes [BR:bmd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BMD_1938 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_26 AP_endonuc_2 ABC_tran_CTD
Motif
Other DBs
NCBI-ProteinID: ADF38791
UniProt: D5DDW2
Position
1940064..1941752
Genome map
AA seq 562 aa AA seqDB search
MTTKKQIKSDLQIAQEATIKPIKEIAEHLDILEAELEPYGHYKAKLSLSVMERLHTKQDG
KVILVTAINPTPAGEGKSTVTVGLAQALHRLGKKAIVAMREPSLGPVMGIKGGAAGGGYA
QVLPMEDINLHFTGDLHAITTANNALAAILDNHIHQGNELRIDTRKITWKRVVDLNDRAL
RQVVIGLGGPMQGVPREDGFDITVASEIMAIFCLASDLQDLKRRLASIVVAYNMDNEPVT
VADLGAQGALTLLLKDAIKPNLVQTLEHTPALIHGGPFANIAHGCNSVIATKMAAKLGDY
VVTEAGFGADLGAEKFLNIKARMADIKPETVVIVATIRALKMHGGVPKKRLNEENIEALE
AGIENLEKHIETIQAFGVPYVVAVNRFVTDSKGEVEALMNWCDSKNVPVALTEVWEKGGE
GGVMLAEKILEVMNETESQFSPLYDVSASIPEKVEAIAKTVYGAQGVDFAPKALKQIQQF
EANGWDHLPICMAKTQYSLSDDQTKIGRPTDFKITVREFRPSLGAGFLVALTGSIMTMPG
LPKKPAALNMDIDENGHALGIF
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacaactaagaagcaaataaaaagtgatttgcaaattgcacaagaggcaacgattaaa
ccgattaaagagattgccgagcacctggatattttagaggccgagctagagccgtacgga
cattataaagccaagctttctttatccgttatggaacgtttacacacaaaacaagatgga
aaagtgattttagttacagctattaatccaactccagcgggagaagggaagtcgacagtg
acggttggcttagctcaggcattacatagattaggtaaaaaagcgattgtcgccatgcgt
gaaccatctcttggtccggtaatgggaattaaaggaggtgccgctggcggcggttatgct
caagtgcttccaatggaggatattaacttacactttactggagacctgcatgccatcaca
acagctaacaacgcactggcagctattttagataaccatatacatcaaggaaatgaattg
cgcattgatacacgtaaaatcacgtggaaacgagtggtagatttaaacgaccgcgcgctg
cgtcaggtcgtcattggattaggtggtccgatgcagggtgttcctcgagaagatggattt
gatattacggtggcatcagaaattatggctattttctgcttagcgtcagatttacaagac
ttgaagcgtcgcttagcgtctattgtggtagcttataacatggacaatgagcctgtaacg
gttgcagacttaggtgcacaaggagcgcttactcttcttttaaaagatgcaattaaaccc
aaccttgtacagacgttggaacataccccagccctcattcacggaggtccttttgctaat
attgcccacggctgcaatagcgtcattgccacaaaaatggctgcaaaactaggcgactat
gtagtaacagaagcgggattcggggcagatttaggtgcagaaaaattcctgaatattaaa
gctcgtatggcagatattaaacctgaaacggtggtaatcgttgcgacaattcgcgctttg
aaaatgcatgggggcgttcctaaaaagcgtttaaatgaagaaaacattgaggctttagaa
gcgggaattgaaaatctggaaaaacatattgaaacgattcaggcattcggcgttccttac
gttgtagccgtgaaccggtttgtgacggactcaaaaggtgaagtagaagcgcttatgaat
tggtgtgattcaaagaatgttcccgttgctttaacagaagtatgggaaaaaggtggagaa
ggcggcgtcatgcttgctgaaaaaattcttgaagtcatgaacgagacagaaagtcagttt
tctcctctttacgatgtgtcggcttcgattccagaaaaagtagaagctattgctaaaacc
gtatacggagcacaaggcgtagattttgctccaaaagcgttaaagcaaatacagcaattt
gaggcaaacgggtgggatcatctgccgatctgtatggccaaaacgcagtattcgttaagt
gatgatcagacgaagattgggcgaccgactgattttaagattacggtaagggaattccgt
ccttcactcggagctgggtttcttgtggcgctaacaggttcaattatgacaatgcctgga
cttccaaaaaaacctgctgcgctcaatatggatattgacgagaatggacatgcactaggg
attttttaa

DBGET integrated database retrieval system