KEGG   Bacillus megaterium DSM 319: BMD_2484Help
Entry
BMD_2484          CDS       T01219                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00071  Fatty acid degradation
bmd00072  Synthesis and degradation of ketone bodies
bmd00280  Valine, leucine and isoleucine degradation
bmd00310  Lysine degradation
bmd00362  Benzoate degradation
bmd00380  Tryptophan metabolism
bmd00620  Pyruvate metabolism
bmd00630  Glyoxylate and dicarboxylate metabolism
bmd00640  Propanoate metabolism
bmd00650  Butanoate metabolism
bmd00900  Terpenoid backbone biosynthesis
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01130  Biosynthesis of antibiotics
bmd01200  Carbon metabolism
bmd01212  Fatty acid metabolism
bmd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMD_2484
   00630 Glyoxylate and dicarboxylate metabolism
    BMD_2484
   00640 Propanoate metabolism
    BMD_2484
   00650 Butanoate metabolism
    BMD_2484
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMD_2484
   00072 Synthesis and degradation of ketone bodies
    BMD_2484
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMD_2484
   00310 Lysine degradation
    BMD_2484
   00380 Tryptophan metabolism
    BMD_2484
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMD_2484
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMD_2484
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMD_2484
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmd04147]
    BMD_2484
Enzymes [BR:bmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMD_2484
Exosome [BR:bmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMD_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADF39330
UniProt: D5DEP8
Position
2472778..2473878
Genome map
AA seq 366 aa AA seqDB search
MTIYQAAIVKAKRTVIGKENGLLKDFHVQELTAPLLKHLSAGIEHEIDDIILGNVVGPGG
NAARLSALEADLPFSIPGMTIDRQCGAGLEAIRMASYLIKAGAGTCYLAGGVESTSTSPF
EKRARFSPDKIGDPDMGIAAENVAKRYNISKDQQDRYALLSHERSWEAFEKRLFEEETLP
LPNVMHDEAFMKKRNLTKLLQKASPVFLKKEGTVTAANSCGINDGACITLVMEEQKARSL
GFQPVLRFIDADISGVSPLYPAIAPVSAIKNIVKRNSLTVDDIDLFEINEAFAVKVVACM
QELGIREEKVNIRGGALTLGHPYGASGAILATRLFYESKRRDMRYVIAALGSGGGIGTAV
LFEVIK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactatctatcaagcagcaattgtaaaagcgaagcgtacggtcattggaaaagaaaac
ggtctactgaaagattttcatgttcaagagctaacggctcctttattaaaacaccttagc
gctggaattgaacatgaaattgatgacattattttagggaatgttgtaggtccaggagga
aacgcagctaggctatccgctttagaagcagacctccctttttctatcccgggaatgact
attgatcgtcagtgcggagctgggttagaggccattcgaatggcgagctatttgataaaa
gcaggtgctggaacgtgttatttagctggaggcgttgaaagtacaagtacttctcctttt
gaaaaaagagcacgtttttctcctgataaaattggtgaccctgacatggggattgcagca
gaaaacgtagccaagcgatacaatatatctaaagatcagcaggacagatatgctctttta
agtcatgaaagaagctgggaggcttttgaaaaaaggttgtttgaagaagaaacgcttcct
cttccaaacgtgatgcacgatgaagcatttatgaaaaaacgaaacctaacaaagctgctg
caaaaagccagccccgtctttttaaaaaaagaaggcaccgtcactgcagcaaacagctgt
ggaattaacgatggagcctgcattacacttgtgatggaagagcaaaaagcgcggtcctta
ggctttcagcccgttttgcgttttattgacgctgatatttcaggagtgtcacctctttac
cctgctattgcaccagtttctgcgattaaaaatatcgtgaagcgaaattctcttacggta
gatgatattgacttatttgaaatcaatgaagcatttgctgttaaagttgtcgcttgcatg
caagaactgggaatacgagaagagaaagtgaatattcgtggaggagcattgactctagga
cacccatacggagcatcaggagctattttagctacgcgtcttttttatgaaagcaagcgc
cgtgacatgcgatatgtcatagcggctttaggaagcggaggcggaataggaacagcggta
ttatttgaagtaatcaaataa

DBGET integrated database retrieval system