KEGG   Bacillus megaterium DSM 319: BMD_2737Help
Entry
BMD_2737          CDS       T01219                                 

Gene name
melA
Definition
(GenBank) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00052  Galactose metabolism
bmd00561  Glycerolipid metabolism
bmd00600  Sphingolipid metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BMD_2737 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    BMD_2737 (melA)
   00600 Sphingolipid metabolism
    BMD_2737 (melA)
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BMD_2737 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: ADF39579
UniProt: D5DHL9
Position
complement(2722215..2723537)
Genome map
AA seq 440 aa AA seqDB search
MSKITFIGAGSTVFAKNILGDCMFVPALAGFEFALYDIDAERLRDSENMLNNLKENYKVN
ITVKAYLNRREALTGAKYVINAIQVGGYKPSTVIDFEIPKKYGLRQTIGDTVGIGGIFRS
LRTIPVLFDFAKDIEEVCPDALFLNYTNPMATLTGAMLRYTNVKTVGLCHSVQVCTKDLF
DSLGMDHEGIQEKIAGINHMAWLLEVKRDGQDLYPEIKRLAKEKQKTKHHDMVRFELMDK
FGYYITESSEHNAEYHPYFIKHKYPNLVDQFNIPLDEYPRRCEEQISNWESMREEMVNNS
QLTHTRSHEYGSRIIEAMETNVPFKFAGNVLNIGGLISNLPTKACVEVPCVVDRSGIMPT
YVGDLPEQLAALNRTNINTQLLTIEAAVTRKREHIYQAAMLDPHTNAELSMNDIIRMCDD
LIEAHGEWLPDFTGKVNQYV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaattacatttatcggagcgggaagtacagtttttgcaaaaaatattttagga
gactgcatgtttgtgcctgctttagctggctttgaatttgcgctatacgatatagatgct
gagcgtttaagagattcggaaaatatgctaaacaatctaaaagaaaactataaagtgaat
attacggttaaagcctatttgaaccgcagagaagctttaacaggagcaaagtatgtgatt
aatgccattcaagtaggcggttacaaaccaagcaccgtcattgattttgaaattcctaaa
aaatacggcttgcgtcagacgattggagatacagtaggaattggaggaatcttcagatca
ctgcgcacgattccggtcctgtttgattttgcaaaagatattgaagaagtatgtccagat
gcgctgtttttaaattacaccaatcccatggcaacactaacgggtgcaatgctgcgctat
accaatgtaaagacggtaggcctttgtcacagtgttcaagtatgtacaaaagatttattt
gattctctcggaatggatcatgaaggaatacaagagaaaatcgcaggcattaaccatatg
gcatggctgctagaagtaaaaagagatggacaagacttatacccagaaatcaagcgtctg
gcaaaagaaaaacaaaagacaaagcatcacgatatggtgcgttttgagctaatggataag
ttcggttattatattactgaatcgtctgagcataacgcagagtatcatccatactttatt
aaacataaatatccaaatcttgttgatcagtttaacatccctcttgatgaatacccgcgt
cgatgcgaagagcaaattagcaattgggaatcaatgagagaagaaatggttaacaacagt
cagttaactcatacacgttcacatgagtacggatctagaatcattgaagcaatggagaca
aacgtgccgtttaaatttgccggtaacgtattaaatatcgggggcttaattagtaacctg
ccgacaaaagcgtgcgtagaagttccatgtgttgtagaccgaagcggcattatgccgact
tatgtaggagacttacctgagcagcttgcggcgttaaatcgtacgaatattaatacgcaa
ttgctaacaattgaagcagcagtcactagaaaaagagagcacatctatcaagcagcgatg
ctagatcctcatacaaatgcggaattatctatgaatgacattattcgtatgtgcgatgat
ttaattgaagcccacggcgagtggctgcctgattttacagggaaagtgaaccaatacgtg
taa

DBGET integrated database retrieval system