KEGG   Bacillus megaterium DSM 319: BMD_2890Help
Entry
BMD_2890          CDS       T01219                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00620  Pyruvate metabolism
bmd00630  Glyoxylate and dicarboxylate metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01200  Carbon metabolism
Module
bmd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMD_2890 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMD_2890 (glcB)
Enzymes [BR:bmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BMD_2890 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADF39731
UniProt: D5DGK9
Position
complement(2867832..2870009)
Genome map
AA seq 725 aa AA seqDB search
MTNYKQVGNLKVAPVLYQFINEEALPGSGLSTENFWSDFEALVTELTPVNKHLLEKRDQL
QARINAWHQENPDGDFSEYKSFLTRIGYLEDKTEDFLIGTEGVDSEIAYQAGPQLVVPVN
NARYAINAANARWGSLYDALYGTDAISEENGASRTSSYNPIRGEKVIAFAKNFLNEVVPL
VQSSHVEVVQYSLENGKLVAQLNDGSLTELQEEEKFVGYQGEEESPDALLFKNNGLHFEV
QIDRTDSIGKTDDAGVKDILMEAALTTIMDCEDSVAAVDAEDKVDVYRNWLGLMKGDLTS
TFKKGSQNMTRRLNPDRTYISPDKKKISLSGRSLMFVRNVGHLMTNSAVLDRNGNEIYEG
ILDSVITSLIAKHTLLKNGTYQNSKKSSIYIVKPKMHGSKEVAFANTLFNSIEDMLGLER
HTIKIGVMDEERRTTLNLKACIKEVKDRVAFINTGFLDRTGDEIHTSMEAGAVIRKNDMK
TSKWLQGYEQSNVNVGLASGFQGRAQIGKGMWAMPDMMAEMLKQKVGHLKAGANTAWVPS
PTAATLHALHYHQIDVRDVQNELLTQSTDLQDDILQIPVAEKPNWSKDEIQQELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISSQHVANWLHHGICTKEQVTETLKR
MAKVVDQQNENDPLYQPMARNYSASIAFQAACDLVFQGYDQPNGYTEPILHRRRIEAKAK
AAIKQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaactacaaacaagttggaaatctgaaagtagccccagttctctatcaatttatc
aatgaggaagctcttccgggcagcggcctaagtacagaaaatttttggtctgattttgaa
gcgttagtaaccgagttaacacccgtaaataaacatttgttagaaaagcgtgatcagctg
caagctcgaattaatgcatggcatcaagaaaaccctgacggtgactttagcgaatacaaa
tcgtttttaacgagaattggctatttagaagacaagacagaagattttcttattggtaca
gaaggagtagacagcgaaattgcctatcaggcaggaccgcagcttgttgtaccagtaaat
aacgcccggtacgctattaacgctgctaatgcacgctggggaagtctctatgatgctctt
tacggcactgatgcaatcagtgaagaaaatggagcttcgcgcacgagttcttataatcca
attcgaggagaaaaagttattgcgtttgcgaaaaattttcttaatgaagttgttccgctc
gttcagtcttctcatgtggaagtggttcagtacagccttgaaaatggaaagcttgtcgct
caattaaacgatggcagtttaaccgaattacaggaagaagagaaatttgtagggtatcaa
ggagaagaagaaagccctgatgctcttttattcaaaaacaacggcctgcattttgaagtt
caaattgatcgtacggattcgattggtaaaacagacgatgcgggtgtaaaagatatttta
atggaagcagctcttacgacgattatggactgtgaagattcagtagcggcagtagacgca
gaagataaagtagatgtttaccgcaactggctgggattaatgaaaggtgatttgacgtct
acttttaaaaaaggaagtcaaaacatgacaaggcgtttaaatccagaccgtacctatatt
tctccggacaagaaaaagatttcactgtctggccgttcgcttatgtttgttcgaaacgtt
gggcatttaatgacaaacagcgctgttttagatcgaaatggcaacgaaatctatgaaggt
attttagacagcgtgattactagtttaattgccaaacacaccttgcttaaaaacggtacg
tatcaaaattctaaaaagagctctatctatatcgttaaaccgaaaatgcacggctccaaa
gaagtagcttttgccaatacgctatttaattcaattgaagatatgctagggcttgagcgt
catacaattaaaattggcgtaatggacgaagagcgccgcacgacgcttaatttaaaagcg
tgtatcaaagaagtaaaagaccgagtggcttttattaatactggattcttggatcgaacg
ggtgacgaaattcatacctcaatggaagcgggcgctgttattcgtaaaaatgatatgaaa
acgtctaaatggcttcaaggctacgagcagtctaatgtaaatgtagggttagcaagcgga
ttccaaggccgcgctcaaatcggaaaaggaatgtgggcaatgccggatatgatggcggaa
atgcttaaacaaaaagtgggacatttaaaagcaggagcgaatacggcatgggtgccttca
ccaaccgcagcaacgcttcatgctcttcactatcatcaaattgatgtaagagatgttcaa
aacgaattgcttactcagtctactgatttacaagatgacattttgcaaattcctgtggca
gaaaaaccaaattggagcaaagatgaaattcagcaggagctcgacaacaacgctcaagga
atacttggttatgtagtaaggtgggtggaccaaggagtagggtgctcaaaagtaccggat
attaataatgtagggctaatggaagaccgggcaacgcttcgtatttctagtcagcacgtg
gctaactggcttcatcatggaatttgtacaaaggaacaagtaacggagacgctcaagcga
atggcaaaagtagtggatcaacaaaatgaaaatgatcctctgtatcagccaatggcacgg
aactacagcgcatccattgcttttcaagcagcctgcgatttagtatttcaaggctatgat
cagccaaacggctatacggagcccattttacaccgccgccgtatagaagcaaaggcaaaa
gcagctataaaacagtaa

DBGET integrated database retrieval system