KEGG   Bacillus megaterium DSM 319: BMD_3573Help
Entry
BMD_3573          CDS       T01219                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00360  Phenylalanine metabolism
bmd00362  Benzoate degradation
bmd00620  Pyruvate metabolism
bmd00621  Dioxin degradation
bmd00622  Xylene degradation
bmd00650  Butanoate metabolism
bmd01100  Metabolic pathways
bmd01120  Microbial metabolism in diverse environments
bmd01220  Degradation of aromatic compounds
Module
bmd_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMD_3573 (mhpF)
   00650 Butanoate metabolism
    BMD_3573 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BMD_3573 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMD_3573 (mhpF)
   00622 Xylene degradation
    BMD_3573 (mhpF)
   00621 Dioxin degradation
    BMD_3573 (mhpF)
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BMD_3573 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA TrkA_N F420_oxidored DapB_N CoA_binding NAD_binding_3 SSPI 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADF40406
UniProt: D5DK18
Position
complement(3456720..3457637)
Genome map
AA seq 305 aa AA seqDB search
MRKVKAAIIGSGNIGTDLMYKLQRSEFIELTAVLGIDPDSDGLKRAREAGYQTYSNGIKA
LAENPDLAEIIFDATSAKAHVRHAKILKDLGKMVIDLTPAAKGPFVCPPVNLGENLESEN
VNMITCGGQATIPIIYAINQVADVTYGEIVATISSLSAGPGTRANIDEFTVTTRKAIEKV
GGADCGKAIILLNPADPPILMRDTIYCKVKNMNKEAIQKAIKDMVKKVQEYVPGYNLKQE
PLFDSDQVTVFLEVTGAGDYFPSYAGNLDIMTAAAAKVAEDYARYKLEESLYGGIKKERA
MTNET
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaagtaaaagccgcaattattggctcaggaaatattgggacagatttgatgtat
aagcttcagcgcagtgaatttatcgagttaacagctgtacttggaattgatccggattca
gatggtctaaaaagagcgagagaagcaggatatcaaacatacagcaatggtataaaagcc
cttgctgaaaatccagatctggcggaaattatttttgatgctacatcggctaaggctcac
gttagacatgcaaagattttaaaagacttaggaaaaatggttatcgacttaactcctgct
gccaaaggacctttcgtgtgtcctcccgttaatcttggagaaaatcttgaatcagaaaat
gtaaacatgattacgtgcggcggacaagcgacgattcctatcatctatgcaatcaaccaa
gttgcagatgtaacatatggagaaattgtagctactatttctagcctaagcgctggacca
ggaacacgagcaaatattgatgagtttactgttaccacaaggaaagctattgaaaaagta
ggcggtgccgactgcggaaaagctattattctcttaaatccggctgatccacctatctta
atgcgcgatacaatttattgtaaagtgaaaaatatgaataaggaagctattcaaaaggct
atcaaagatatggtcaaaaaagtacaagaatatgtaccgggctataatttaaagcaagaa
ccattatttgatagtgatcaagtaacagtctttttagaggtaactggagccggagattat
tttccttcttatgccggtaacttagatattatgacggctgctgcagcgaaggttgcggaa
gattatgcccgctacaaactcgaagagagcttatatggaggaataaagaaagagagggct
atgacgaatgaaacgtaa

DBGET integrated database retrieval system