KEGG   Bacillus megaterium DSM 319: BMD_3891Help
Entry
BMD_3891          CDS       T01219                                 

Gene name
argI
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00220  Arginine biosynthesis
bmd00330  Arginine and proline metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01130  Biosynthesis of antibiotics
bmd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BMD_3891 (argI)
   00330 Arginine and proline metabolism
    BMD_3891 (argI)
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BMD_3891 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADF40724
UniProt: D5DKK5
Position
complement(3747037..3747936)
Genome map
AA seq 299 aa AA seqDB search
MKKDISIIGVPMDYGQTRRGVDMGPSAIRYAGMNTRLEALGYTVHDEGDIKVEIKERADV
DKNTNLKNLAAVASGNEQLAARVEEVREQDRFPLILGGDHSIAIGTLAGVAKGSENLGVI
WYDAHGDLNTAETSPSGNIHGMPLAVSLGIGHPVLLNIGGYTPKIKPENLVIIGARSLDD
GEKELIKEKGIKVYTMHEIDRLGMTQVMKETIDYLSGTDGVHLSLDLDGLDPDDAPGVGT
PVKGGISYRESHLAMEMLAEADIVTSAEFVEVNPILDQHNKTAEVAVALMSSLFGDKLL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagacatttcaattatcggtgtacccatggattacggacaaacaagaaggggt
gtagacatggggccgagcgcgatccgctatgcaggcatgaatacacgcttagaagctctt
ggctataccgtacacgatgaaggcgatattaaagtagaaattaaagagcgggcagacgta
gataaaaatacgaatttgaaaaacttagcggctgtagccagcggaaatgaacagcttgct
gcacgagttgaagaagtgagagagcaagaccgctttccgttaatattaggcggagaccac
agcattgcgattggaacacttgcaggagtcgcaaaaggttcagaaaatttaggcgttatt
tggtatgatgctcatggtgatttaaacacagctgaaacatctccatcaggcaacattcac
ggcatgccattagcggtgagccttggtattggacatcctgtacttttaaatattggaggg
tataccccaaaaattaaacctgaaaatctcgttattatcggtgcacgctcattggatgat
ggtgaaaaagagttaattaaagaaaaaggaattaaagtgtataccatgcatgaaattgat
cgtttaggtatgacgcaagtgatgaaagaaacgattgattatttaagcggcacagacggt
gtgcacctgtcgctggacttagacggcttagatcccgatgatgcaccaggcgtaggtaca
cctgtaaaaggcggcatcagctaccgagaaagtcatttagcaatggaaatgctagcggaa
gcagacatagttacatctgctgaatttgtagaggtgaaccccattttagatcagcataac
aaaactgcagaagtagcggttgcgttaatgagttcattgtttggtgataagcttttataa

DBGET integrated database retrieval system