KEGG   Bacillus megaterium DSM 319: BMD_4961Help
Entry
BMD_4961          CDS       T01219                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00260  Glycine, serine and threonine metabolism
bmd00750  Vitamin B6 metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01230  Biosynthesis of amino acids
Module
bmd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMD_4961 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMD_4961 (thrC)
Enzymes [BR:bmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMD_4961 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADF41761
UniProt: D5DM06
Position
complement(4779024..4780088)
Genome map
AA seq 354 aa AA seqDB search
MMWKGLLAEYKEFLPVTEKTPMLTLHEGNTPLIHLAQLSKELGIDLHVKVEGLNPTGSFK
DRGMVMAVAKAKEEGSNTVICASTGNTSAAAAAYASRAGMRCIVVIPNGKIAMGKLAQAV
MYGAEIVAIEGNFDQALSMVRKLSETSPVALVNSVNPYRIEGQKTASFEICEQLGKAPDV
LAIPVGNAGNITAYWKGFKEYSERHQTSLPHMHGFEAEGAAAIVRNQVIENPETIATAIR
IGNPASWDYAVNAAKESNGKIDEVTDEQILEAYRTIARKEGVFAEPGSCASIAGVFKDVA
SGKIAKGSTVVAVLTGNGLKDPNVAIDAHNVKPVVLPNDEEKVFEYIQGVVASC
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggaaaggtctattagctgaatataaagaatttttacctgtaacagagaaaaca
cctatgcttacattacatgaaggaaatacgcctttaattcatcttgctcagttatcaaaa
gagctaggcattgatctacatgtgaaagtagaagggttaaatccaacggggtcatttaaa
gaccgcggaatggtaatggctgtagcaaaagcaaaagaagaaggaagcaatacggttatt
tgtgcatctacaggtaacacatccgcagctgcagcagcttatgcatcacgcgctggcatg
cgctgtatcgttgttattccaaatggaaaaattgcgatggggaaattagctcaagctgtt
atgtatggtgcagaaattgtagcaattgaaggaaactttgaccaagcactttctatggtt
cgtaagctgagtgaaacatcaccggttgcacttgtaaactctgtaaacccataccgtatt
gaagggcaaaaaacagcttctttcgagatttgtgaacagcttggaaaagcgcctgacgtt
ttagctattccagtggggaatgcaggaaacattacagcttactggaaaggcttcaaagaa
tacagtgagcgtcaccaaacgtctcttcctcacatgcacgggtttgaagcagaaggtgca
gcggcgatcgtgcgtaatcaagttatcgaaaatccagaaacaattgcaacggctattcga
atcggaaatccagcaagctgggattatgctgtaaacgcagcaaaagaatcaaacggaaaa
attgatgaagtaacagatgaacaaatcttagaagcatatcgtacaattgcacgcaaagaa
ggtgtatttgcagagccaggttcttgcgcttcaatagctggtgtgtttaaagatgtagct
tctggtaaaattgcaaaaggttcaacggttgtagctgtactaacaggtaacggattaaaa
gatccaaacgtagcaatcgatgctcataatgtaaaaccagtggttttaccaaatgatgaa
gaaaaggtatttgagtatatccaaggtgtcgttgcttcatgctag

DBGET integrated database retrieval system