KEGG   Bacillus megaterium DSM 319: BMD_5171Help
Entry
BMD_5171          CDS       T01219                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00071  Fatty acid degradation
bmd00072  Synthesis and degradation of ketone bodies
bmd00280  Valine, leucine and isoleucine degradation
bmd00310  Lysine degradation
bmd00362  Benzoate degradation
bmd00380  Tryptophan metabolism
bmd00620  Pyruvate metabolism
bmd00630  Glyoxylate and dicarboxylate metabolism
bmd00640  Propanoate metabolism
bmd00650  Butanoate metabolism
bmd00900  Terpenoid backbone biosynthesis
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01130  Biosynthesis of antibiotics
bmd01200  Carbon metabolism
bmd01212  Fatty acid metabolism
bmd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMD_5171 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BMD_5171 (mmgA)
   00640 Propanoate metabolism
    BMD_5171 (mmgA)
   00650 Butanoate metabolism
    BMD_5171 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMD_5171 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BMD_5171 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMD_5171 (mmgA)
   00310 Lysine degradation
    BMD_5171 (mmgA)
   00380 Tryptophan metabolism
    BMD_5171 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMD_5171 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMD_5171 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMD_5171 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmd04147]
    BMD_5171 (mmgA)
Enzymes [BR:bmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMD_5171 (mmgA)
Exosome [BR:bmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMD_5171 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADF41970
UniProt: D5DM86
Position
complement(4987881..4989044)
Genome map
AA seq 387 aa AA seqDB search
MGKTVIVSAVRTPFGKLGGSVSGLKAAELGGKAIQAASKGRTEIDSVIMGCVLQGGQGQL
PSRQAMHYAGLPWQVETETINKVCASGMRSITTADQLIRLGEAKTIIAGGMESMSNAPYL
LPKARWGFRMGDSIVTDLMIHDGLTCSFTGVQMGTYGNEIAAEMDISREKQDEWALRSHQ
LAVESEEKGRWTAERISVDIPSKKGTITVQKDEGPRKDTSLEKLSSLRPVFGHSGTITAG
NAPSVNDGAAALMLMDEEVAKANGYEPLATIVNHTSLAMEPREFPKTPGFAINKLLQKTN
KTVDDIALFEINEAFSAVALMSMEIAGLPAEKVNVNGGAVALGHPIGASGARIVVTLIHE
LRRRGGGLGIASICSGGGQGDAIMVEV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtggggaaaacagttattgtgagtgcagttcgaacaccttttggaaaattaggtggcagc
gtaagtggactaaaagcggcagagctaggcgggaaagcgattcaagcagcgtcaaaggga
cgtacagaaattgattccgttattatgggatgcgtgctgcaagggggccaaggacagctg
ccttctaggcaagccatgcattatgcaggtttaccgtggcaagtagagacggaaaccatt
aataaagtttgtgcatcaggcatgcgcagtattacaactgctgatcagctgattcgatta
ggagaagcaaaaacaatcattgcaggtggaatggaatccatgagtaatgcaccgtacctt
cttccaaaagcaagatgggggttccgtatgggagatagcattgtgacagatttgatgatt
catgacggtttgacatgcagctttacaggggttcaaatgggtacatatggaaatgaaata
gctgctgaaatggatatttcccgagaaaagcaggatgaatgggcccttcgcagtcatcaa
ttagcagtagagtcagaagagaaagggagatggaccgcagaaagaatttcagttgatatt
ccgtctaaaaaaggaacgataacggttcaaaaagatgaaggaccaagaaaagacacgtcg
ttagaaaaactttcttctcttcggcctgtatttggccacagcggaaccattacagcagga
aatgcacctagcgtgaatgacggagcagctgcgctcatgctaatggatgaagaagtggca
aaagcaaatggctatgagccgttggctacgattgtaaaccatacttctcttgcgatggag
ccaagggaatttccgaaaacgcctgggtttgctattaacaagctattgcaaaaaacaaat
aagacagtagacgatattgcgctgtttgaaatcaatgaagctttttcagcagtagcgttg
atgagtatggaaattgcagggcttccggctgaaaaagtaaatgtcaacggcggggctgta
gcacttggacatccgattggagcaagcggcgcccgtattgttgtaacgctcattcatgaa
ttaagacgacgaggcggcggactaggcattgcttctatttgcagcggcggcggccaaggt
gatgccatcatggtagaagtataa

DBGET integrated database retrieval system