KEGG   Brucella melitensis bv. 1 16M: BMEI0141Help
Entry
BMEI0141          CDS       T00072                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase component (e2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00020  Citrate cycle (TCA cycle)
bme00310  Lysine degradation
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01130  Biosynthesis of antibiotics
bme01200  Carbon metabolism
Module
bme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMEI0141
  Amino acid metabolism
   00310 Lysine degradation
    BMEI0141
Enzymes [BR:bme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMEI0141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 DUF2967 HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: AAL51323
UniProt: F8WJX2
Position
I:138874..140100
Genome map
AA seq 408 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT
AKEGDTVEVGELLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQPAPA
AAKLLAESGLSADQVEGSGKRGQVLKGDVLEAITKGVSAAPAAPVAARPASSADDASREE
RVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVFEKKHGVKLGFMGF
FTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVVPVIRDADQMSIAEVEK
ELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAPQSGILGMHKIQERPMV
VGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaattcgcgttcccacgcttggggagtccgttaccgaggcaaccatcgga
aagtggttcaagaaggctggtgaagccattgctgtcgatgagccgctggtggaactggaa
accgacaaggtgacggtcgaagtgcccgcaccggctgcgggtgttctggccgaaatcacg
gccaaagaaggcgatacggtcgaagtgggcgaactgctcggccagatttccagtgacggg
gcagcggttgccgccgcaccggcccagaagaaggaggaagccaagcctgcagccgccgct
cctgctgctgcaccggtcgcatcggcttcgtcgggcccggccatgcagccggcgccggct
gctgcgaagcttctggctgaaagcggtctttccgccgatcaggtcgaaggttccggcaag
cgcggccaggtgctcaaaggtgacgttctcgaggccatcacgaaaggcgtttcggcggct
cctgccgctccggttgccgcgcgtccggcctcctcggctgatgacgcatcgcgcgaagag
cgtgtgaagatgacccgtctgcgccagaccattgcgcgccgcctgaaggatgcccagaac
acggctgccatgctcaccaccttcaacgaggtggacatgtcggcagtcatggagctgcgt
aacaagtataaggacgtctttgaaaagaagcatggcgtgaagcttggcttcatgggcttc
ttcaccaaggcagtgacgcatgcgctgaaggaaatcccggctgtcaacgccgagatcgac
ggcacggacatcgtctacaagaacttctgccatgtcggcatggctgtcggcaccgacaag
ggcctcgtcgttccggtcatccgcgatgccgaccagatgtcgattgcggaagtggaaaag
gaactggcacgtctcgccagggctgcgcgtgacggctcgctttccatggccgatatgcag
ggcggcacctttaccatcaccaatggcggtgtttacggttcgctcatgtccacgccgatc
ctcaatgcgccgcagtcgggcattctcggtatgcacaagatccaggaacgcccgatggtc
gtcggtggccagatcgtggtccgcccgatgatgtatctggcgctttcctacgatcaccgc
atcgtggacggcaaggaagccgtgaccttcctcgtgcgtgtgaaggaaagcctggaagat
ccggaacgtctggttctcgatctctag

DBGET integrated database retrieval system