KEGG   Brucella melitensis bv. 1 16M: BMEI0266Help
Entry
BMEI0266          CDS       T00072                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00020  Citrate cycle (TCA cycle)
bme00620  Pyruvate metabolism
bme01100  Metabolic pathways
bme01120  Microbial metabolism in diverse environments
bme01200  Carbon metabolism
bme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMEI0266
   00620 Pyruvate metabolism
    BMEI0266
Enzymes [BR:bme01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BMEI0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_3 HlyD_D23 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AAL51448
UniProt: Q8YJ20
Position
I:276058..279534
Genome map
AA seq 1158 aa AA seqDB search
MSFAPKPISKILVANRSEIAIRVFRAANELGLKTVTIWAEEDKLSLHRFKADESYQVGRG
PHLDRDLGPIESYLSIDEIIRVAKLSGADAIHPGYGLLSESPEFAEACAENGIVFIGPKP
ETMRRLGNKVAARNLAIEIGVPVVPATDPLPDDMDEVKKLAAQIGYPLMLKASWGGGGRG
MRAIRAEADLAREVMEAKREAKAAFGKDEVYLEKLVERARHVEVQILGDTYGNAVHLFER
DCSIQRRNQKVVERAPAPYLNDAQRRELADYGLKIAHATDYIGAGTVEFLMDADTGKFYF
IEVNPRIQVEHTVTEEVTGIDIVKAQIHILEGFAIGTPESGVPRQEDIRLNGHALQCRIT
TEDPEQNFIPDYGRIQAYRSAAGFGIRLDGGTAYSGAFITRYYDPLLVKVTASGATPLEA
IHRMDRALREFRIRGVATNLTFLEAIINHPKFLSNDYTTRFIDTTPELFEQMKRQDRATK
LLTYIADVTVNGHPETKGRAKPARDAAKPRVPWFGDKLVADGTKQLLDQLGPKKFAEWMR
NEKRALITDTTMRDGHQSLLATRVRTYDIARIANAYAQALPNLFSLECWGGATFDVSMRF
LTEDPWERLALVREGAPNLLLQMLLRGANGVGYKSYPDNVVKYFVREAARAGIDLFRVFD
SLNWVENMRVSMDAVLEENKLCEAAICYTGDILNPDRAKYDLNYYVNLAKEVEKAGAHII
AVKDMAGLLKPAAARVLFKALREETDLPIHFHTHDTSGISAATVLAAIDAGVDVVDAAMD
ALSGNTSQPCLGSIVEALHGSERDSGLDPDLIRRISFYWEAVRHQYAAFESDLKGPASEV
YLHEMPGGQFTNLKEQARSLGLETRWHEVAQAYADVNRMFGDIVKVTPSSKVVGDMALMM
VAQDLTVADVENPAKDIAFPDSVVSMMRGDLGQPPSGWPEALQKKVLKDEKPFTVRPGSL
LPAADLDAERKSFEDSVGRKLSDQEFASALMYPKVFTDYATAHETYGPTSVLPTPVYFYG
LKPEEEVFVDLERGKTLVIVNQAMSETDEKGMVTVFFELNGQPRRIKVPNRAKGASGGVR
RKVEAGNDKQVGAPMPGVISTVAVVAGQKVTQGDVLLSIEAMKMETAIHAERDGTIAEVL
VRPGEQIDAKDLLIVYAE
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttcgctccaaagcctatctcgaaaattctggtcgccaaccgatctgaaatcgca
attcgcgtattccgcgccgccaatgagctggggctcaaaacggtgaccatatgggctgag
gaagacaagctttctctgcatcgcttcaaggcggacgaaagctatcaggtcggtcgcgga
ccgcacctggatcgcgatcttggccccattgaaagctatctttccattgacgaaatcatc
cgcgttgccaagctttcgggcgccgatgcgatccatccaggttacggtctcctgtcggaa
agcccggaatttgccgaagcctgcgcggaaaacggtatcgtcttcatcgggccgaagccg
gaaaccatgcgccgcctcggcaacaaggtcgccgcgcgcaatctcgctatcgagattggc
gtgccggtggtgcctgccaccgatccgctgccggatgatatggatgaggtgaagaagctt
gccgcccagatcggctatccgctgatgctgaaagcaagctggggcggcggcggccgcggt
atgcgcgccatccgggctgaagccgatcttgcccgcgaggtgatggaagccaagcgcgag
gccaaggcggcctttggcaaggatgaagtttatctcgaaaagctggtggagcgtgcccgc
catgtcgaagtgcagatattgggcgatacgtacggcaatgcggtccatctttttgagcgt
gactgctccatccagcgccgtaaccagaaggtcgtggagcgcgcgcctgcaccctatctc
aacgatgcgcagcgccgcgagctggccgattatggcctgaagatcgcgcatgccaccgat
tatatcggtgctggcacggttgagttcctcatggatgccgataccggcaagttctatttc
atcgaggtcaatccacgcattcaggtggagcatacggtcacggaagaagtgaccggcatc
gatatcgtcaaggcgcagatccatattctggaaggctttgccatcggcacgccggaatcg
ggcgtgccgcgccaggaggatatccgcctcaatggccacgcgctgcaatgccgcatcaca
acggaagacccggaacagaatttcatccccgattacgggcgcattcaggcctatcgttcg
gcggcgggcttcggcatccgtctcgatggcggcacggcctattcgggcgcattcatcacc
cgttattacgacccgcttctggtaaaggtgacggcatccggcgcgacgccgcttgaagcc
attcaccgcatggaccgcgccttgcgcgagttccgcattcgcggcgtggcaacgaacctc
accttcctcgaagcgatcatcaatcatccgaaattcctgtcgaacgattatacgacccgt
ttcatcgatacgacgccggaattgttcgagcagatgaagcggcaggatcgcgccaccaag
cttttgacctatattgccgatgtgaccgtcaacggccatcccgaaaccaagggccgcgcg
aaacccgccagggatgctgccaagccgcgcgtgccgtggtttggcgacaagctggtcgct
gacggcaccaaacagcttctggaccagcttgggccgaagaagtttgccgaatggatgcgc
aatgaaaagcgcgcgctgattactgataccaccatgcgcgatggccaccagtcattgctt
gccacgcgcgtgcgcacctatgatattgcgcggatcgccaatgcttacgcgcaggcgctg
ccaaacctgttctcgctggaatgctggggcggggctactttcgacgtctccatgcgcttc
ctgaccgaagacccgtgggagcgtctggcactggtgcgcgaaggcgcgcccaacctcctg
ttgcagatgcttctgcgcggtgcgaacggggttggctacaaatcctatccggacaatgtg
gtgaaatatttcgtgcgcgaggcagcgcgcgcgggcattgacctgttccgcgttttcgac
agcctcaactgggttgagaacatgcgcgtgtcgatggatgcggtgctggaggaaaacaag
ctctgtgaagcggcgatctgctatacgggcgatattttgaacccggatcgcgccaaatac
gaccttaattattacgtcaatctggcgaaggaagtggaaaaggctggcgcgcatattatt
gcggtcaaggatatggcgggcttgctgaagcctgccgccgcgcgcgtgctgttcaaggcg
ctgcgcgaggaaaccgatctgccgatccatttccacacacatgatacgtcgggcatttcg
gcggcgaccgtgcttgctgcaatcgatgcgggcgtggatgtcgtggatgcagcgatggac
gcactttcgggcaatacatcgcagccctgcctcggttccatcgttgaagcgctgcatggt
tccgagcgtgattcggggctcgacccggatttgatccgccgtatttccttttattgggaa
gcggtgcgccatcaatatgcagcttttgaaagcgacctcaagggaccggcttcggaagtc
tatcttcacgaaatgccgggtggccagttcaccaatctgaaggaacaggcgcgctcgctg
gggcttgaaacgcgctggcatgaagtggcgcaggcctatgccgatgtgaaccgcatgttc
ggcgatatcgtcaaggtcacgccatcctccaaggtggtgggcgacatggcgctgatgatg
gttgcccaagacctcaccgttgccgatgtcgagaaccctgccaaggatattgccttcccg
gattcggtggtttccatgatgcgtggcgatctcggccagccgccatccggctggccggaa
gccttgcagaaaaaggttctgaaagatgaaaagcctttcaccgtgcgccccggctcgctt
ctgcctgccgccgatctcgatgcggaacgcaagagctttgaggacagtgtcggccgcaag
ctttccgatcaggaatttgcttcggcgctgatgtatccgaaggtcttcaccgattatgct
acggcgcatgaaacctatggtccgacgagcgtgctgccgacgccggtttatttctacggc
ctcaagccggaagaagaagtttttgtcgatctggagcgtggcaagacgctggtgatcgtc
aatcaggctatgagcgagaccgacgagaagggcatggtgacggtgttcttcgagctgaac
ggccagccgcgccgcatcaaggtgccaaaccgtgccaagggtgcttccggtggtgtccgc
cgcaaggtggaggcgggcaatgacaaacaggtcggtgcgccaatgccgggcgttatctcc
accgttgcggttgtggcaggccagaaggttacgcagggcgacgtgcttctatccatcgag
gcgatgaagatggaaaccgccatccatgccgaacgcgatggcactatcgcggaagtgctg
gtccgccccggcgagcagatcgacgcgaaggatttgctcatcgtttacgccgagtaa

DBGET integrated database retrieval system