KEGG   Brucella melitensis bv. 1 16M: BMEI0274Help
Entry
BMEI0274          CDS       T00072                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00071  Fatty acid degradation
bme00072  Synthesis and degradation of ketone bodies
bme00280  Valine, leucine and isoleucine degradation
bme00310  Lysine degradation
bme00362  Benzoate degradation
bme00380  Tryptophan metabolism
bme00620  Pyruvate metabolism
bme00630  Glyoxylate and dicarboxylate metabolism
bme00640  Propanoate metabolism
bme00650  Butanoate metabolism
bme00900  Terpenoid backbone biosynthesis
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01130  Biosynthesis of antibiotics
bme01200  Carbon metabolism
bme01212  Fatty acid metabolism
bme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMEI0274
   00630 Glyoxylate and dicarboxylate metabolism
    BMEI0274
   00640 Propanoate metabolism
    BMEI0274
   00650 Butanoate metabolism
    BMEI0274
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMEI0274
   00072 Synthesis and degradation of ketone bodies
    BMEI0274
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMEI0274
   00310 Lysine degradation
    BMEI0274
   00380 Tryptophan metabolism
    BMEI0274
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMEI0274
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMEI0274
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMEI0274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bme04147]
    BMEI0274
Enzymes [BR:bme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMEI0274
Exosome [BR:bme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMEI0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAL51456
UniProt: Q8YJ12
Position
I:285920..287434
Genome map
AA seq 504 aa AA seqDB search
MLRHMLKEERMSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAAD
VDEVILGQVLTAGEGQNPARQAAMGAGCPKETTAFAINQLCGSGLRAVALGMQQIVSGDA
KIIVAGGQESMSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQW
QLSRSEQDEFALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVL
AKLKPAFDKEGTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIM
GTGPIPATRKALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGH
PIGACGARVLTTLLYEMERRDAKRGLATLCISAAAWAWPFVSSGIDPVLERHLKPTANFG
RVPEEGCFFPAKVNAEPKHAGESVLFRLRPMACDCGQIPDVVRTNTENPAISDSSLIRSR
VVPYINRALPPHPSLGKASARIET
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgccacatgcttaaggaggaaagaatgtccgatccgaaatccatcgtcatcgcc
agtgcagcgcgcaccgcggtgggtgcctttaatggcgcctttgccaatgttcctgctcat
gaactgggtgcagtggccatcaaggctgctctggagcgtgctggtgtcgatgcggcggat
gtcgatgaggttattctggggcaggtgctgacggcaggcgaagggcagaatcccgcccgt
caggccgccatgggggccggttgcccgaaggaaaccaccgcttttgccatcaaccagctc
tgcggttccggcctgcgggcggttgcgctcgggatgcagcagattgtttccggcgatgcg
aagattatcgtggcgggcgggcaggaatccatgtccatggcgccgcattgtgcctatctg
cgctccggcgtgaagatgggcgatttcaagatgatcgacaccatgctgaaagacggcctg
accgatgctttccatggctatcacatgggcatcaccgctgaaaatattgcgcgccaatgg
cagttgagccgcagcgagcaggacgagttcgcactcgcctcgcagcacaaagccgaggcc
gcgcagaaggcaggccgcttcgatgaggagatcgtgcctttcaccgtcaaggcccgcaag
ggggatgttgtggtttcggcagatgaatatatccgtccgggcacgacgatggaggtgctg
gccaagctgaagccggcttttgacaaggaaggcacggtgacggcgggcaatgcatccggc
atcaatgacggtgccgcagcggttgtgctgatggatgctggcgaggcagccaggcgtggc
gtgaagcctctggcgcgcatcgtatcctgggcgacggctggcgttgatccgtcgatcatg
ggaaccgggccgatccccgcaacgcggaaggcgctggaaaaggcaggctggagcgttggc
gaccttgatcttgttgaggccaatgaggcctttgcagcgcagtcatgcgcggtggtgcgc
gatctgggtctcaatcctgaaatcgtcaatgtcaatggcggggcaatcgccatcggccat
ccgatcggcgcctgcggcgcccgcgtgctgacgacgctgctctacgaaatggagcgtcgc
gatgccaagcgtggtctggcgacgctttgtatctcggcggcggcatgggcgtggcccttt
gtgtcgagcgggattgatccggttttagaacgtcatctgaaaccaaccgccaatttcggg
cgtgtgccggaagaggggtgtttttttccggcaaaagttaacgcagaaccgaaacatgca
ggggaaagcgtgctgtttcggctccgccctatggcgtgtgactgcggccagataccagat
gttgtgagaacaaatacagaaaatccagccatcagcgattcgtcgctgattcgttccaga
gtcgttccatatattaaccgggcgcttccgcctcatccctctcttgggaaggcatctgcc
cgcattgaaacttaa

DBGET integrated database retrieval system