KEGG   Brucella melitensis bv. 1 16M: BMEI0409Help
Entry
BMEI0409          CDS       T00072                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00630  Glyoxylate and dicarboxylate metabolism
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01200  Carbon metabolism
Module
bme_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMEI0409
Enzymes [BR:bme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BMEI0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAL51590
UniProt: Q8YIN4
Structure
PDB: 

Position
I:complement(424989..426278)
Genome map
AA seq 429 aa AA seqDB search
MTDFYSLIPSAPKGRFDGIERAHTAEDVKRLRGSVEIKYSLAEMGANRLWKLIHEEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETAEGKGLSVDTWFAPIVADAEAGFGDPLDAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLIVARTDAEAAKLLTSDIDERDQ
PFVDYEAGRTAEGFYQVKNGIEPCIARAIAYAPYCDLIWMETSKPDLAQARRFAEAVHKA
HPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARG
YKDRQMAAYSELQQAEFAAEADGYTATKHQREVGTGYFDAVSLAITGGQSSTTAMKESTE
TAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttttacagcctcatcccttcggcacccaagggccgcttcgacggcattgaa
cgtgcgcatacggccgaagacgtgaaaaggctgcgcggttcggtggagataaagtattcg
ctggccgaaatgggtgcaaaccgcctctggaagctgatccacgaggaagatttcgtcaat
gcgctgggcgcgctttccggcaaccaggccatgcagatggttcgcgccgggttgaaggcg
atctacctttccggctggcaggttgcagcagacgccaacacggcatcagccatgtatccc
gaccagtcgctctatccggccaatgccgggccagagcttgcaaagcgcatcaaccgcacg
ctgcaacgcgccgaccagatcgaaaccgccgaaggcaaggggctttcggttgacacatgg
ttcgcgcccatcgtggcggatgccgaggcaggctttggcgacccgctggatgccttcgag
atcatgaaagcctatatcgaggccggtgctgcgggcgttcactttgaagaccagcttgct
tcggaaaagaagtgcggccatctgggcggcaaggttctgatcccgaccgcagcgcacatc
cgcaacctcaacgcggcacgccttgcagccgacgtcatgggcacgccgaccctcatcgtg
gcgcgcacggatgcggaagcagccaagcttctgacgtcggatatcgacgagcgcgaccag
cctttcgtcgattacgaagcaggccgcacggcggaaggcttctatcaggtgaagaatggc
atcgagccatgcatcgcccgtgcgattgcctatgcgccttattgcgatctgatctggatg
gaaacgtccaagcctgatctcgcacaggcccgtcgcttcgcggaagccgtgcacaaggcg
catccgggcaagctgctcgcctataactgctcgccgtcgttcaactggaaaaagaacctc
gacgacgcgacgattgccaagttccagcgcgagctgggcgcgatgggctacaagttccag
ttcatcacgctggctggcttccaccagctcaactacggcatgttcgagctggcacgcggc
tacaaggatcgtcagatggcggcttattccgagctgcaacaggcggaatttgcagccgaa
gccgatggctacacggcaaccaagcaccagcgcgaagtcggcaccggctatttcgatgcc
gtgtcgctcgcaatcaccggcggccagtcttcgaccaccgccatgaaggaatcgaccgaa
accgcacagttcaagccggctgccgagtag

DBGET integrated database retrieval system