KEGG   Brucella melitensis bv. 1 16M: BMEI0703Help
Entry
BMEI0703          CDS       T00072                                 

Definition
(GenBank) cbid protein
  KO
K02188  cobalt-precorrin-5B (C1)-methyltransferase [EC:2.1.1.195]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00860  Porphyrin and chlorophyll metabolism
bme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMEI0703
Enzymes [BR:bme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.195  cobalt-precorrin-5B (C1)-methyltransferase
     BMEI0703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiD
Motif
Other DBs
NCBI-ProteinID: AAL51884
UniProt: Q8YHU3
Position
I:complement(728396..729505)
Genome map
AA seq 369 aa AA seqDB search
MNDETTPANKNPEKAELRCGWTTGACATAATKAALTALITGEFPDPVGIILPKGEVPYFQ
LAYEGLGEGYAMAGIVKDAGDDPDVTHGATIISTVYPAPPGTGIIFRAGEGVGTVTREGL
AIPPPGEAAINPVPRRMMTEICEAICAEYGLPADLVITISVPGGEEIAQKTWNPRLGIIG
GISILGTTGVVHPFSCSAWIHSIHRGIDVARAAGQKHVLGATGSTSEDAAQALYNLPDFA
ILDMGDFAGGVLKYLREHPIDRLTIAGGFAKLTKLAQGALDLHSSRSQVDKGFLWQIAER
AGAPADMKERILLANTAMEVLELTQSIGIDIAGPIALEARQTALKTLRGAPVEVEIIVTD
RKGNILARV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgaaactacccccgcaaataaaaaccctgaaaaagcagaacttcggtgcggc
tggacgacgggcgcttgcgcgacagccgccaccaaggctgccttgacggcgcttatcacc
ggcgaatttcccgatccggtgggcattattctgcccaagggcgaagtaccctatttccag
cttgcctatgagggactgggcgaaggctatgccatggcgggcatcgtcaaggatgcgggc
gacgacccggatgtaacgcatggcgcaaccatcatctcgacggtctatcccgccccgccc
ggcaccggcatcatctttcgcgcgggcgaaggcgtcggcacggtcacgcgcgaggggctc
gccatccccccccccggcgaggcggcgatcaacccggttccacgccgcatgatgacagaa
atatgtgaggcaatatgcgctgaatacggcctccccgccgatctcgtcatcaccatatcg
gttcccggcggcgaagaaatcgcacagaaaacatggaacccacgcctcggcatcatcggc
ggcatatccattttgggcaccacgggcgtcgtgcatcctttctcctgttcggcatggatc
cattccatccatcgcggcatcgatgttgcgcgcgctgccgggcaaaaacatgttctcggc
gcaaccggctccacctcagaggatgccgcgcaggcgctctataatctgcccgatttcgcc
attctggatatgggcgattttgcaggcggcgttctcaaatacctgcgcgaacaccccatc
gacaggctcaccattgcgggcggctttgccaagctcaccaaacttgcccaaggcgcgctt
gacctccattcgtcgcgctcacaggtggataagggctttctctggcagatcgccgaacgc
gctggcgcaccggcagacatgaaggagcggattctccttgcgaacacggcaatggaagtg
cttgaattgactcaatcaatcggcatcgacattgcagggccgatcgcgcttgaagcaagg
caaacggcgctcaaaaccctgcgcggcgcgccagtcgaagtcgagattatcgttacggac
cgcaagggaaacattcttgcccgcgtctga

DBGET integrated database retrieval system